DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6048 and Sb

DIOPT Version :9

Sequence 1:NP_572282.1 Gene:CG6048 / 31528 FlyBaseID:FBgn0029827 Length:362 Species:Drosophila melanogaster
Sequence 2:NP_001287355.1 Gene:Sb / 41958 FlyBaseID:FBgn0003319 Length:787 Species:Drosophila melanogaster


Alignment Length:269 Identity:89/269 - (33%)
Similarity:134/269 - (49%) Gaps:50/269 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 RIINGTEASLGATRHQVGIRKALNDGYF-FGTGHLCGGSLIRPGWVLTAAHCFVDQII------- 101
            ||:.|..|:.|....||.:|:.   .:| |.:.|.|||:||...|:.||.||..|.:|       
  Fly   543 RIVGGKSAAFGRWPWQVSVRRT---SFFGFSSTHRCGGALINENWIATAGHCVDDLLISQIRIRV 604

  Fly   102 --YDGTFVPKEEFIVVMGNLDRYNRTNTLTFTIEERIMQLDKFDLSTYDKDIALLMLNGTVPTGH 164
              ||.:.|.::...:..|              :.::::. .|:...||:.|:||:.|...:... 
  Fly   605 GEYDFSHVQEQLPYIERG--------------VAKKVVH-PKYSFLTYEYDLALVKLEQPLEFA- 653

  Fly   165 PTIRPIALNRFAIPE------GVVCQVTGWGN-TEDGYVSDILMTVDVPMISEEHC---INDSDL 219
            |.:.||.|     ||      |:...|||||. :|.|.:..:|..|.||::|.::|   ...:..
  Fly   654 PHVSPICL-----PETDSLLIGMNATVTGWGRLSEGGTLPSVLQEVSVPIVSNDNCKSMFMRAGR 713

  Fly   220 GHLIQPGMICAGYLEVGEKDACAGDSGGPLVCQSE-----LAGVVSWGIQCALPRLPGVYTEVSY 279
            ...|....:|||| |.|.:|:|.|||||||..:|:     |||::||||.||...||||.|.:|.
  Fly   714 QEFIPDIFLCAGY-ETGGQDSCQGDSGGPLQAKSQDGRFFLAGIISWGIGCAEANLPGVCTRISK 777

  Fly   280 YYDWILQNM 288
            :..|||:::
  Fly   778 FTPWILEHV 786

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6048NP_572282.1 Tryp_SPc 45..284 CDD:214473 86/263 (33%)
SbNP_001287355.1 Tryp_SPc 543..782 CDD:214473 86/263 (33%)
Tryp_SPc 544..785 CDD:238113 88/265 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24253
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.