DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6048 and CG12951

DIOPT Version :9

Sequence 1:NP_572282.1 Gene:CG6048 / 31528 FlyBaseID:FBgn0029827 Length:362 Species:Drosophila melanogaster
Sequence 2:NP_649880.1 Gene:CG12951 / 41110 FlyBaseID:FBgn0037677 Length:265 Species:Drosophila melanogaster


Alignment Length:253 Identity:84/253 - (33%)
Similarity:126/253 - (49%) Gaps:31/253 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 RIINGTEASLGATRHQVGIRKALNDGYFFGTGHLCGGSLIRPGWVLTAAHCFVDQIIYDGTFVPK 109
            |::|||::|:......|.:|.  .||     .|.||||:|...:|:|||||...:        |.
  Fly    29 RVVNGTDSSVLKYPFVVSLRS--YDG-----SHSCGGSIISKHFVMTAAHCTNGR--------PA 78

  Fly   110 EEFIVVMG--NLDRYNRTNTLTFTIEERIMQLDKFDLSTYD-KDIALLMLNGTVPTGHPTIRPIA 171
            :...:..|  |:.... .|.:..   ::|:|.:.||.:..: .||:|||:.........::.|:.
  Fly    79 DTLSIQFGVTNISAMG-PNVVGI---KKIIQHEDFDPTRQNANDISLLMVEEPFEFDGVSVAPVE 139

  Fly   172 LN--RFAIPE---GVVCQVTGWG-NTEDGYVSDILMTVDVPMISEEHCINDSDLGHLIQPGMICA 230
            |.  .||:|:   ||...:.||| |...|.|.|.|..|.:.:.|:|.|.:..: |.......||.
  Fly   140 LPALAFAVPQSDAGVEGVLIGWGLNDTYGSVQDTLQEVSLKIYSDEECTSRHN-GQTDPKYHICG 203

  Fly   231 GYLEVGEKDACAGDSGGPLVCQSELAGVVSWGIQ-CALPRLPGVYTEVSYYYDWILQN 287
            | ::.|.|..|:|||||||:...:..|:|||.|: |.:...||||.:||.|.|||..|
  Fly   204 G-VDEGGKGQCSGDSGGPLIYNGQQVGIVSWSIKPCTVAPYPGVYCKVSQYVDWIKSN 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6048NP_572282.1 Tryp_SPc 45..284 CDD:214473 81/248 (33%)
CG12951NP_649880.1 Tryp_SPc 29..257 CDD:214473 81/248 (33%)
Tryp_SPc 30..260 CDD:238113 82/250 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.