DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6048 and Klk4

DIOPT Version :9

Sequence 1:NP_572282.1 Gene:CG6048 / 31528 FlyBaseID:FBgn0029827 Length:362 Species:Drosophila melanogaster
Sequence 2:NP_001004101.1 Gene:Klk4 / 408210 RGDID:1303228 Length:256 Species:Rattus norvegicus


Alignment Length:250 Identity:81/250 - (32%)
Similarity:118/250 - (47%) Gaps:41/250 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 RIINGTEASLGATRHQVGIRKAL--NDGYFFGTGHLCGGSLIRPGWVLTAAHCFVDQIIYDGTFV 107
            |||.|.:    ...|....:.||  .|..||     |.|.|:.|.|||:||||..|         
  Rat    31 RIIQGQD----CLPHSQPWQAALFSEDNAFF-----CSGVLVHPQWVLSAAHCIQD--------- 77

  Fly   108 PKEEFIVVMG--NLDRYNRTNTLTFTIEERI-MQLDKFDLSTYDKDIALLMLNGTVPTGHPTIRP 169
               .:.|.:|  ||:......:.  .:|..: :|...::..::..|:.|:.||.:|...: |||.
  Rat    78 ---SYTVGLGLHNLEGSQEPGSR--MLEAHLSIQHPNYNDPSFANDLMLIKLNESVMESN-TIRR 136

  Fly   170 IALNRFAIPEGVVCQVTGWGNTEDGYVSDILMTVDVPMISEEHC-INDSDLGHLIQPGMICAGYL 233
            |.:.......|..|.|:|||..::|.:..:|..|::.:.|||.| :....:.||   .|.|||  
  Rat   137 IPVASQCPTPGDTCLVSGWGRLKNGKLPSLLQCVNLSVASEETCRLLYDPVYHL---SMFCAG-- 196

  Fly   234 EVG---EKDACAGDSGGPLVCQSELAGVVSWGI-QCALPRLPGVYTEVSYYYDWI 284
              |   .||.|.||||||:||...|.|:||.|. :|..|.:|.|||.:..:.:||
  Rat   197 --GGPDRKDTCNGDSGGPIVCNRSLQGLVSMGQGECGQPGIPSVYTNLCKFTNWI 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6048NP_572282.1 Tryp_SPc 45..284 CDD:214473 79/248 (32%)
Klk4NP_001004101.1 Tryp_SPc 35..249 CDD:238113 76/244 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.