DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6048 and Mcpt1l3

DIOPT Version :9

Sequence 1:NP_572282.1 Gene:CG6048 / 31528 FlyBaseID:FBgn0029827 Length:362 Species:Drosophila melanogaster
Sequence 2:XP_038949770.1 Gene:Mcpt1l3 / 408209 RGDID:1302933 Length:270 Species:Rattus norvegicus


Alignment Length:255 Identity:76/255 - (29%)
Similarity:109/255 - (42%) Gaps:44/255 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 PGRIINGTEASLGATRHQVGIRKALNDGYFFGTGHLCGGSLIRPGWVLTAAHCFVDQIIYDGTFV 107
            |..|:.|.|:...:..:...::.....||.    ..|||.||...:|||||||       :|   
  Rat    39 PEEIVGGVESIPHSRPYMAHLKITTEKGYV----TFCGGFLISRQFVLTAAHC-------NG--- 89

  Fly   108 PKEEFIVVMGNLDRYNRTNT-LTFTIEERIMQLDKFDLSTYDKDIALLMLNGTVP-TGHPTIRPI 170
              .|..|.:|..|...|.:| ....:|::|:. ..::..:...||.||.|...|. |....:.|:
  Rat    90 --REITVTLGAHDVSKRESTQQKLKVEKQIIH-KNYNFFSNIHDIMLLKLEKQVELTPAVDVVPL 151

  Fly   171 ALNRFAIPEGVVCQVTGWGNTEDGYVSD------ILMTVDVPMISEEHCINDSDLGHLIQ----- 224
            ......|..|.:||..|||.|.   |:|      .|..|::.::..|.|...||..:..|     
  Rat   152 PSPSDFIDPGTMCQAAGWGQTG---VTDPTSYTYTLREVELRIMDVEACKIFSDYDYNFQMCVGS 213

  Fly   225 PGMICAGYLEVGEKDACAGDSGGPLVCQSELAGVVSWGIQCALPRLPGVYTEVSYYYDWI 284
            ||.:.:.|         .|||||||:|.....|:||.|.:.|.|  |.|:|.:|.|..||
  Rat   214 PGRMRSPY---------EGDSGGPLLCAGVAHGIVSHGREDAKP--PAVFTRISPYVPWI 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6048NP_572282.1 Tryp_SPc 45..284 CDD:214473 73/251 (29%)
Mcpt1l3XP_038949770.1 Tryp_SPc 42..263 CDD:238113 75/252 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.