DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6048 and Jon74E

DIOPT Version :9

Sequence 1:NP_572282.1 Gene:CG6048 / 31528 FlyBaseID:FBgn0029827 Length:362 Species:Drosophila melanogaster
Sequence 2:NP_001189126.2 Gene:Jon74E / 39959 FlyBaseID:FBgn0023197 Length:271 Species:Drosophila melanogaster


Alignment Length:281 Identity:84/281 - (29%)
Similarity:117/281 - (41%) Gaps:71/281 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 GRIINGTEASLGATRHQVGIR-KALNDGYFFGTGHLCGGSLIRPGWVLTAAHCFVDQIIYDGTFV 107
            |||..|..|......:|||:. :..||.|.:     ||.|||...::||||||.           
  Fly    30 GRIAGGELARANQFPYQVGLSIEEPNDMYCW-----CGASLISDRYLLTAAHCV----------- 78

  Fly   108 PKEEFIVV---MGNLDRYNRTNTLTFTIEERIMQLDKFDLSTYDKDIALLMLNGTVPTGHP---- 165
              |:.:.:   :|.:.|......:..|..|..:..| ::..:.:.||||:.|        |    
  Fly    79 --EKAVAITYYLGGVLRLAPRQLIRSTNPEVHLHPD-WNCQSLENDIALVRL--------PEDAL 132

  Fly   166 ---TIRPIAL-------NRFAIPEGVVCQVTGWG--NTEDGYVSDILMTVDVPMISEEHCINDSD 218
               :||||.|       |.:   :.|....:|||  |.|...:||.|..|...:.|.|.|    :
  Fly   133 LCDSIRPIRLPGLSSSRNSY---DYVPAIASGWGRMNDESTAISDNLRYVYRFVESNEDC----E 190

  Fly   219 LGHL-IQPGMICAGYLEVGEKDACAGDSGGPLVCQSE------LAGVVSWGIQCALPR-LPGVYT 275
            ..:. |:|..||..  ..|.|..|.||||||||....      |.||.|:|.:....: .|.|:|
  Fly   191 YSYANIKPTNICMD--TTGGKSTCTGDSGGPLVYSDPVQNADILIGVTSYGKKSGCTKGYPSVFT 253

  Fly   276 EVSYYYDWILQNMGENGEGSG 296
            .::.|.|||       ||.||
  Fly   254 RITAYLDWI-------GEVSG 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6048NP_572282.1 Tryp_SPc 45..284 CDD:214473 77/266 (29%)
Jon74ENP_001189126.2 Tryp_SPc 31..262 CDD:214473 77/266 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.