DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6048 and CG6462

DIOPT Version :9

Sequence 1:NP_572282.1 Gene:CG6048 / 31528 FlyBaseID:FBgn0029827 Length:362 Species:Drosophila melanogaster
Sequence 2:NP_648011.1 Gene:CG6462 / 38681 FlyBaseID:FBgn0035663 Length:319 Species:Drosophila melanogaster


Alignment Length:283 Identity:89/283 - (31%)
Similarity:118/283 - (41%) Gaps:67/283 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 TKAIRPRFNADPGRIINGTEASLGATRHQVGIRKALNDGYFFGTGHLCGGSLIRPGWVLTAAHCF 96
            |.|:|.       ||..|..|:.|...:|||:...|:.....    .||||||...:|||||||.
  Fly    70 TAAVRT-------RIAGGELATRGMFPYQVGLVIQLSGADLV----KCGGSLITLQFVLTAAHCL 123

  Fly    97 VDQI---IYDGTFVPKEEFIVVMGNLDRYNRTNTLTFTIEERIMQLDKFDLSTYDKDIALLMLNG 158
            .|.|   ||.|..|    |..|..:::.      |..|..:.|:..|......| .|:||:.|..
  Fly   124 TDAIAAKIYTGATV----FADVEDSVEE------LQVTHRDFIIYPDYLGFGGY-SDLALIRLPR 177

  Fly   159 TVPTGHPTIRPIAL------NRFAIPEGVVCQVTGWGNTEDGYVSD-------ILMTVDVPMISE 210
            .|.|.. .::||.|      ..|.:  |.|..::||     ||:.|       :|..:|..:|.:
  Fly   178 KVRTSE-QVQPIELAGEFMHQNFLV--GKVVTLSGW-----GYLGDSTDKRTRLLQYLDAEVIDQ 234

  Fly   211 EHCI------NDSDLGHLIQPGMICAGYLEVGEKDACAGDSGGPLVCQ----SELAGVVSWGIQ- 264
            |.||      ..|...||...|.        ..:.||.||||||:|..    |.|.||.|:|.. 
  Fly   235 ERCICYFLPGLVSQRRHLCTDGS--------NGRGACNGDSGGPVVYHWRNVSYLIGVTSFGSAE 291

  Fly   265 -CALPRLPGVYTEVSYYYDWILQ 286
             |.:.. |.|||.::.|..||.|
  Fly   292 GCEVGG-PTVYTRITAYLPWIRQ 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6048NP_572282.1 Tryp_SPc 45..284 CDD:214473 83/266 (31%)
CG6462NP_648011.1 Tryp_SPc 76..311 CDD:214473 83/266 (31%)
Tryp_SPc 77..314 CDD:238113 85/269 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24253
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.