DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6048 and CG1299

DIOPT Version :9

Sequence 1:NP_572282.1 Gene:CG6048 / 31528 FlyBaseID:FBgn0029827 Length:362 Species:Drosophila melanogaster
Sequence 2:NP_647862.1 Gene:CG1299 / 38496 FlyBaseID:FBgn0035501 Length:511 Species:Drosophila melanogaster


Alignment Length:311 Identity:93/311 - (29%)
Similarity:130/311 - (41%) Gaps:60/311 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 PSGLRGATTRTHLDTKAIRPRFNADPGRIINGTEASLGATRHQVGIRKALNDGYF---------- 72
            |:| :|.|..|...::.:....:..|.|::| .|...|:|   ||..|.:..|..          
  Fly   217 PTG-QGITNTTPAPSQIVPKNTDEIPRRLLN-VEEGCGST---VGYFKKIVGGEVSRKGAWPWIA 276

  Fly    73 -------FGTGHLCGGSLIRPGWVLTAAHCFVDQIIYDGTFVPKEEFIVVMGNLDRYNRTNTLTF 130
                   .|:...|||:||....|||||||    |..|..||...|.     :|.....|..:..
  Fly   277 LLGYDDPSGSPFKCGGTLITARHVLTAAHC----IRQDLQFVRLGEH-----DLSTDTETGHVDI 332

  Fly   131 TIEERIMQLDKFDLSTYDKDIALLMLNGTVPTGHPTIRPIALNRFAIPE-----GVVCQVTGWGN 190
            .|...:...| ::......|:|:|.|...|.. ...|.||.|...|...     |.:..|.|||.
  Fly   333 NIARYVSHPD-YNRRNGRSDMAILYLERNVEF-TSKIAPICLPHTANLRQKSYVGYMPFVAGWGK 395

  Fly   191 T-EDGYVSDILMTVDVPMISEEHCIN---------DSDLGHLIQPGMICAGYLEVGEKDACAGDS 245
            | |.|..:.:|..:.:|:...:.|:.         .:|   .....::|||.|. |.||.|.|||
  Fly   396 TMEGGESAQVLNELQIPIYDNKVCVQSYAKEKRYFSAD---QFDKAVLCAGVLS-GGKDTCQGDS 456

  Fly   246 GGPLVCQSE--------LAGVVSWGIQCALPRLPGVYTEVSYYYDWILQNM 288
            ||||:....        |.||||:||.||.|.:||||:...|:.|||:|.:
  Fly   457 GGPLMLPEPYQGQLRFYLIGVVSYGIGCARPNVPGVYSSTQYFMDWIIQQV 507

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6048NP_572282.1 Tryp_SPc 45..284 CDD:214473 84/278 (30%)
CG1299NP_647862.1 CLIP 37..93 CDD:197829
CLIP 164..216 CDD:288855
Tryp_SPc 260..503 CDD:214473 76/257 (30%)
Tryp_SPc 261..503 CDD:238113 76/256 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24253
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.