DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6048 and KLK1

DIOPT Version :9

Sequence 1:NP_572282.1 Gene:CG6048 / 31528 FlyBaseID:FBgn0029827 Length:362 Species:Drosophila melanogaster
Sequence 2:NP_002248.1 Gene:KLK1 / 3816 HGNCID:6357 Length:262 Species:Homo sapiens


Alignment Length:267 Identity:83/267 - (31%)
Similarity:112/267 - (41%) Gaps:49/267 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 RIINGTEASLGATRHQVGIRKALNDGYFFGTGHLCGGSLIRPGWVLTAAHCFVDQIIYDGTFVPK 109
            ||:.|.|..    :|....:.||   |.|.| ..|||.|:...||||||||..|           
Human    24 RIVGGWECE----QHSQPWQAAL---YHFST-FQCGGILVHRQWVLTAAHCISD----------- 69

  Fly   110 EEFIVVMGNLDRYNRTNTLTFT---------------IEERIMQLDKFDLSTYDKDIALLMLNGT 159
             .:.:.:|..:.::..||..|.               :|....|.|:    .|..|:.||.|...
Human    70 -NYQLWLGRHNLFDDENTAQFVHVSESFPHPGFNMSLLENHTRQADE----DYSHDLMLLRLTEP 129

  Fly   160 VPTGHPTIRPIALNRFAIPEGVVCQVTGWGNTEDGYVS--DILMTVDVPMISEEHCINDSDLGHL 222
            ..|....::.:.|.......|..|..:|||:.|....|  |.|..||:.::..:.|    ...|:
Human   130 ADTITDAVKVVELPTEEPEVGSTCLASGWGSIEPENFSFPDDLQCVDLKILPNDEC----KKAHV 190

  Fly   223 --IQPGMICAGYLEVGEKDACAGDSGGPLVCQSELAGVVSWG-IQCALPRLPGVYTEVSYYYDWI 284
              :...|:|.|:|| |.||.|.|||||||:|...|.||.||| :.|..|..|.|...|..|..||
Human   191 QKVTDFMLCVGHLE-GGKDTCVGDSGGPLMCDGVLQGVTSWGYVPCGTPNKPSVAVRVLSYVKWI 254

  Fly   285 LQNMGEN 291
            ...:.||
Human   255 EDTIAEN 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6048NP_572282.1 Tryp_SPc 45..284 CDD:214473 79/258 (31%)
KLK1NP_002248.1 Tryp_SPc 25..257 CDD:238113 80/260 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.