DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6048 and Tmprss4

DIOPT Version :9

Sequence 1:NP_572282.1 Gene:CG6048 / 31528 FlyBaseID:FBgn0029827 Length:362 Species:Drosophila melanogaster
Sequence 2:XP_038937788.1 Gene:Tmprss4 / 367074 RGDID:1305033 Length:478 Species:Rattus norvegicus


Alignment Length:249 Identity:87/249 - (34%)
Similarity:124/249 - (49%) Gaps:32/249 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 RIINGTEASLGATRHQVGIRKALNDGYFFGTGHLCGGSLIRPGWVLTAAHCFVDQIIYDGTFVPK 109
            |::.|.|||..:...||.|:        :...|:||||::...|:|||||||       ..::..
  Rat   245 RVVGGVEASADSWPWQVSIQ--------YNKQHVCGGSILDHHWILTAAHCF-------RKYLDV 294

  Fly   110 EEFIVVMGNLDRYNRTNTLTFTIEERIMQLDKFDLSTYDKDIALLMLNGTVP-TGHPTIRPIAL- 172
            ..:.|..|:    |:..........:|...:...|...:|||||:.|.  :| |...::|||.| 
  Rat   295 SSWKVRAGS----NKLGNSPSLPVAKIFIAEPNPLQPKEKDIALVKLK--MPLTFSGSVRPICLP 353

  Fly   173 --NRFAIPEGVVCQVTGWGNTED--GYVSDILMTVDVPMISEEHCINDSDLGHLIQPGMICAGYL 233
              :...||...| .|.|||.||:  |.:||.|:...|.:|....|..:......:..||:|||..
  Rat   354 FSDEELIPTMPV-WVIGWGFTEENGGKMSDTLLQASVQVIDSARCNAEDAYQGEVTAGMLCAGTP 417

  Fly   234 EVGEKDACAGDSGGPLVC---QSELAGVVSWGIQCALPRLPGVYTEVSYYYDWI 284
            : |.||.|.|||||||:.   :.::.|:||||..|..|..|||||:|:.|.|||
  Rat   418 Q-GGKDTCQGDSGGPLMYHYDKWQVVGIVSWGYGCGSPSTPGVYTKVTAYLDWI 470

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6048NP_572282.1 Tryp_SPc 45..284 CDD:214473 85/247 (34%)
Tmprss4XP_038937788.1 LDLa 99..133 CDD:238060
SRCR_2 149..238 CDD:413346
Tryp_SPc 245..470 CDD:214473 85/247 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.