DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6048 and TMPRSS9

DIOPT Version :9

Sequence 1:NP_572282.1 Gene:CG6048 / 31528 FlyBaseID:FBgn0029827 Length:362 Species:Drosophila melanogaster
Sequence 2:NP_001382442.1 Gene:TMPRSS9 / 360200 HGNCID:30079 Length:1093 Species:Homo sapiens


Alignment Length:263 Identity:88/263 - (33%)
Similarity:130/263 - (49%) Gaps:50/263 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 GRIINGTEASLGATRHQVGIRKALNDGYFFGTGHLCGGSLIRPGWVLTAAHCF------VDQIIY 102
            |||:.|.|||.|....|..:|:        ...|.||.::|...|:::|||||      ...:.|
Human   235 GRIVGGMEASPGEFPWQASLRE--------NKEHFCGAAIINARWLVSAAHCFNEFQDPTKWVAY 291

  Fly   103 DG-TFVPKEEFIVVMGNLDRYNRTNTLTFTIEERIMQLDK---FDLSTYDKDIALLMLNGTVPTG 163
            .| |::...|                 ..|:..:::|:.|   ::..|.|.|:|:|.|...:|.|
Human   292 VGATYLSGSE-----------------ASTVRAQVVQIVKHPLYNADTADFDVAVLELTSPLPFG 339

  Fly   164 ---HPTIRPIALNRFAIPEGVVCQVTGWGNTEDGYV--SDILMTVDVPMISEEHCINDSDLGHLI 223
               .|...|.|.:.|  |....|.::|||..::.::  .::|....|.::.:..|.  |..||.:
Human   340 RHIQPVCLPAATHIF--PPSKKCLISGWGYLKEDFLVKPEVLQKATVELLDQALCA--SLYGHSL 400

  Fly   224 QPGMICAGYLEVGEKDACAGDSGGPLVCQSE-----LAGVVSWGIQCALPRLPGVYTEVSYYYDW 283
            ...|:|||||: |:.|:|.|||||||||:..     |||:|||||.||..|.||||..|:...||
Human   401 TDRMVCAGYLD-GKVDSCQGDSGGPLVCEEPSGRFFLAGIVSWGIGCAEARRPGVYARVTRLRDW 464

  Fly   284 ILQ 286
            ||:
Human   465 ILE 467

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6048NP_572282.1 Tryp_SPc 45..284 CDD:214473 84/258 (33%)
TMPRSS9NP_001382442.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.