DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6048 and CG8170

DIOPT Version :9

Sequence 1:NP_572282.1 Gene:CG6048 / 31528 FlyBaseID:FBgn0029827 Length:362 Species:Drosophila melanogaster
Sequence 2:NP_610441.2 Gene:CG8170 / 35908 FlyBaseID:FBgn0033365 Length:855 Species:Drosophila melanogaster


Alignment Length:306 Identity:95/306 - (31%)
Similarity:121/306 - (39%) Gaps:74/306 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 ATTRTHLDTKAIRPRFNADPG------------RIINGTEASLGATRHQVGIRKALNDGYFFGTG 76
            |...|.|..|...| .|.:|.            ||:.|.:|..|:...|..||        .|:.
  Fly   579 AVDLTDLPQKNYGP-VNNEPSCGISLAKQTAQRRIVGGDDAGFGSFPWQAYIR--------IGSS 634

  Fly    77 HLCGGSLIRPGWVLTAAHCFVDQIIYDGTFVPKEEFIVVMGNLDRYNRTNTL---TFTIEERIMQ 138
            . ||||||....|:||.||.       ....|::.. |.:|:....:....|   ||.:.     
  Fly   635 R-CGGSLISRRHVVTAGHCV-------ARATPRQVH-VTLGDYVINSAVEPLPAYTFGVR----- 685

  Fly   139 LDKFDLSTYDK--------DIALLMLNGTVPTGH--PTIRPIALNRFAIPE------GVVCQVTG 187
              :.|:..|.|        ||::|.|..||   |  |.|.||.|     ||      |......|
  Fly   686 --RIDVHPYFKFTPQADRFDISVLTLERTV---HFMPHIAPICL-----PEKNEDFLGKFGWAAG 740

  Fly   188 WGNTEDG--YVSDILMTVDVPMISEEHC---INDSDLGHLIQPGMICAGYLEVGEKDACAGDSGG 247
            ||....|  .....|..||||:|....|   ...:.:..:|...|:||||.. |.||:|.|||||
  Fly   741 WGALNPGSRLRPKTLQAVDVPVIENRICERWHRQNGINVVIYQEMLCAGYRN-GGKDSCQGDSGG 804

  Fly   248 PLVCQSE----LAGVVSWGIQCALPRLPGVYTEVSYYYDWILQNMG 289
            ||:....    |.||||.|..||....||:|..||...||:...:|
  Fly   805 PLMHDKNGRWYLIGVVSAGYSCASRGQPGIYHSVSKTVDWVSYVVG 850

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6048NP_572282.1 Tryp_SPc 45..284 CDD:214473 86/266 (32%)
CG8170NP_610441.2 Tryp_SPc 611..845 CDD:214473 86/266 (32%)
Tryp_SPc 612..846 CDD:238113 86/266 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24253
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.