DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6048 and CG8172

DIOPT Version :9

Sequence 1:NP_572282.1 Gene:CG6048 / 31528 FlyBaseID:FBgn0029827 Length:362 Species:Drosophila melanogaster
Sequence 2:NP_001097235.2 Gene:CG8172 / 35905 FlyBaseID:FBgn0033362 Length:561 Species:Drosophila melanogaster


Alignment Length:270 Identity:83/270 - (30%)
Similarity:120/270 - (44%) Gaps:48/270 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 RIINGTEASLGATRHQVGIRKALNDGYFFGTGHL-CGGSLIRPGWVLTAAHCFVDQIIYDGTFVP 108
            ||:.|.....|:...||.:.|:   |:.  |..| |||:||...||:|||||...        .|
  Fly   315 RIVGGHSTGFGSHPWQVALIKS---GFL--TRKLSCGGALISNRWVITAAHCVAS--------TP 366

  Fly   109 KEEFIVVMGNLD---RYNRTNTLTFTIEERIMQLDKFDLSTYDKDIALLMLNGTVPTGHPTIRPI 170
            .....:.:|..|   :..|.|...:.||.:.:. ..::.:.:..|:||:.|:          |.:
  Fly   367 NSNMKIRLGEWDVRGQEERLNHEEYGIERKEVH-PHYNPADFVNDVALIRLD----------RNV 420

  Fly   171 ALNRFAIP----------EGVVCQVTGWGNTEDGY--VSDILMTVDVPMISEEHC---INDSDLG 220
            ...:..||          .|.:..|.|||.|..|.  |..:|..|||.:||.:.|   ...:...
  Fly   421 VYKQHIIPVCLPPSTTKLTGKMATVAGWGRTRHGQSTVPSVLQEVDVEVISNDRCQRWFRAAGRR 485

  Fly   221 HLIQPGMICAGYLEVGEKDACAGDSGGPLVC----QSELAGVVSWGIQCALPRLPGVYTEVSYYY 281
            ..|....:||||.: |.:|:|.|||||||..    :..|.|:|||||.|....||||||.:..:.
  Fly   486 EAIHDVFLCAGYKD-GGRDSCQGDSGGPLTLTMDGRKTLIGLVSWGIGCGREHLPGVYTNIQRFV 549

  Fly   282 DWILQNMGEN 291
            .||.:.|..:
  Fly   550 PWINKVMAND 559

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6048NP_572282.1 Tryp_SPc 45..284 CDD:214473 80/261 (31%)
CG8172NP_001097235.2 Tryp_SPc 315..552 CDD:214473 80/261 (31%)
Tryp_SPc 316..555 CDD:238113 81/263 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24253
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.