DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6048 and Np

DIOPT Version :9

Sequence 1:NP_572282.1 Gene:CG6048 / 31528 FlyBaseID:FBgn0029827 Length:362 Species:Drosophila melanogaster
Sequence 2:NP_001246213.1 Gene:Np / 35904 FlyBaseID:FBgn0265011 Length:1041 Species:Drosophila melanogaster


Alignment Length:279 Identity:95/279 - (34%)
Similarity:134/279 - (48%) Gaps:45/279 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 LDTKAIRPRFNADPGRIINGTEASLGATRHQVGIRKALNDGYFFGTGHLCGGSLIRPGWVLTAAH 94
            :|.|.:..|......||:.|..|:.|....|:.:|:.....|.    |.||.:|:...|.:||||
  Fly   782 VDYKEVCGRRMFPEPRIVGGANAAFGRWPWQISLRQWRTSTYL----HKCGAALLNENWAITAAH 842

  Fly    95 CFVDQIIYDGTFVPKEEFIVVMGNLDRYNRTNTLTFTIEERIMQL----DKFDLSTYDKDIALLM 155
            | ||.       ||..:.::.:|..|......  .:..:||.:|:    .:||..|::.|:|||.
  Fly   843 C-VDN-------VPPSDLLLRLGEYDLAEEEE--PYGYQERRVQIVASHPQFDPRTFEYDLALLR 897

  Fly   156 LNGTVPTGHPTIRPIALNRFAIPE------GVVCQVTGWGNT-EDGYVSDILMTVDVPMISEEHC 213
            ....| ...|.|.|:     .:|:      |....|||||.. |||.:..:|..|.||:|:...|
  Fly   898 FYEPV-IFQPNIIPV-----CVPDNDENFIGQTAFVTGWGRLYEDGPLPSVLQEVAVPVINNTIC 956

  Fly   214 INDS---DLGHL--IQPGMICAGYLEVGEKDACAGDSGGPLVCQSE------LAGVVSWGIQCAL 267
              :|   ..|::  |....||||: :.|..|:|.||||||:|.|.|      |.||:||||.||.
  Fly   957 --ESMYRSAGYIEHIPHIFICAGW-KKGGYDSCEGDSGGPMVLQRESDKRFHLGGVISWGIGCAE 1018

  Fly   268 PRLPGVYTEVSYYYDWILQ 286
            ...|||||.:|.:.|||.|
  Fly  1019 ANQPGVYTRISEFRDWINQ 1037

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6048NP_572282.1 Tryp_SPc 45..284 CDD:214473 89/260 (34%)
NpNP_001246213.1 Tryp_SPc 797..1035 CDD:214473 89/260 (34%)
Tryp_SPc 798..1038 CDD:238113 91/263 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24253
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.