DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6048 and Phae2

DIOPT Version :9

Sequence 1:NP_572282.1 Gene:CG6048 / 31528 FlyBaseID:FBgn0029827 Length:362 Species:Drosophila melanogaster
Sequence 2:NP_001285871.1 Gene:Phae2 / 34638 FlyBaseID:FBgn0263235 Length:265 Species:Drosophila melanogaster


Alignment Length:251 Identity:68/251 - (27%)
Similarity:104/251 - (41%) Gaps:25/251 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 GRIINGTEASLGATRHQVGIRKALNDGYFFGTGHLCGGSLIRPGWVLTAAHCFVDQ-IIYDGTFV 107
            ||::.|..|:..:..:.|.::        :|..|.|..::|...|::|||||..:: .:...|.|
  Fly    30 GRVVGGKAAAANSAPYIVSMQ--------YGGTHYCAANIINSNWLVTAAHCLANRNQVLGSTLV 86

  Fly   108 PKEEFIVVMGNLDRYNRTNTLTFTIEERIMQLDKFDLSTYDKDIALLMLNGTVPTGHPTIRPIAL 172
            ...  |.|.|......:.....:.|.      |.:...|...||.|: ...|..|....:.|:.|
  Fly    87 AGS--IAVAGTASTTQKRQITHYVIN------DLYTGGTVPYDIGLI-YTPTAFTWTAAVAPVKL 142

  Fly   173 NRFAIPEGVVCQVTGWGNT----EDGYVSDILMTVDVPMISEEHCIND-SDLGHLIQPGMICAGY 232
            ....:.......:.|||:|    ...|...:....::|:||.:.|... ...|..:....:|.|.
  Fly   143 PSSGVRPTGKADLFGWGSTSKTNSPSYPKTLQEAKNIPIISLDSCAAALGSKGQDVHTTNLCTGP 207

  Fly   233 LEVGEKDACAGDSGGPLVCQSELAGVVSWG-IQCALPRLPGVYTEVSYYYDWILQN 287
            | .|....|..|||||||..:.|.|:|||| :.|..|..|.||.:||.:..||..|
  Fly   208 L-TGGTSFCTSDSGGPLVQGNVLIGIVSWGKLPCGQPNSPSVYVQVSSFITWIAAN 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6048NP_572282.1 Tryp_SPc 45..284 CDD:214473 64/245 (26%)
Phae2NP_001285871.1 Tryp_SPc 31..259 CDD:214473 64/245 (26%)
Tryp_SPc 32..262 CDD:238113 65/247 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.