DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6048 and PRSS53

DIOPT Version :9

Sequence 1:NP_572282.1 Gene:CG6048 / 31528 FlyBaseID:FBgn0029827 Length:362 Species:Drosophila melanogaster
Sequence 2:XP_011544118.1 Gene:PRSS53 / 339105 HGNCID:34407 Length:623 Species:Homo sapiens


Alignment Length:312 Identity:86/312 - (27%)
Similarity:123/312 - (39%) Gaps:87/312 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 HLCGGSLIRPGWVLTAAHCFVDQIIYDGTFVPKEEFIVVMGNLDRYNRTNTLTFTIEE---RIMQ 138
            |:|.|||:...|||||||||     ..........:.||:|:|.|    ..|:...||   ..:|
Human    60 HICSGSLVADTWVLTAAHCF-----EKAAATELNSWSVVLGSLQR----EGLSPGAEEVGVAALQ 115

  Fly   139 LDK-FDLSTYDKDIALLMLNGTVPTGH-PTIRPIALNRFAIPEGVVCQVTGWG-NTEDG------ 194
            |.: ::..:...|:|||.|  ..||.| |...|...:||  |.|..|..|||. :|.||      
Human   116 LPRAYNHYSQGSDLALLQL--AHPTTHTPLCLPQPAHRF--PFGASCWATGWDQDTSDGKCWPRL 176

  Fly   195 YVSDIL----MTVDVP-----------------------------------MISEEHC------I 214
            .:.:.|    :||..|                                   :||...|      :
Human   177 KLGEALCLPSVTVSAPNCPGFQSPLLPRSQTLAPAPSLSPAPGTLRNLRLRLISRPTCNCIYNQL 241

  Fly   215 NDSDLGHLIQPGMICAGYLEVGEKDACAGDSGGPLVCQSE-----LAGVVSWGIQCALPRLPGVY 274
            :...|.:..:|||:|.| .:.|.:..|.||||||::|...     .||::|:...||....|.:.
Human   242 HQRHLSNPARPGMLCGG-PQPGVQGPCQGDSGGPVLCLEPDGHWVQAGIISFASSCAQEDAPVLL 305

  Fly   275 TEVSYYYDWI---------LQNMGENGEGSGEES--GEGSGEGSGEGSGEGS 315
            |..:.:..|:         |....|..|.|.|:|  ..||...:|..:|..|
Human   306 TNTAAHSSWLQARVQGAAFLAQSPETPEMSDEDSCVACGSLRTAGPQAGAPS 357

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6048NP_572282.1 Tryp_SPc 45..284 CDD:214473 74/268 (28%)
PRSS53XP_011544118.1 Tryp_SPc 42..316 CDD:238113 75/269 (28%)
Tryp_SPc 43..314 CDD:214473 74/267 (28%)
Tryp_SPc 359..>512 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.