DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6048 and CG11911

DIOPT Version :9

Sequence 1:NP_572282.1 Gene:CG6048 / 31528 FlyBaseID:FBgn0029827 Length:362 Species:Drosophila melanogaster
Sequence 2:NP_608518.1 Gene:CG11911 / 33206 FlyBaseID:FBgn0031249 Length:277 Species:Drosophila melanogaster


Alignment Length:293 Identity:94/293 - (32%)
Similarity:139/293 - (47%) Gaps:45/293 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LAVALLLIFLPSGLRGATTRTHLDTKAIRPRFNADPGRIINGTEASLGATRHQVGIRKALNDGYF 72
            |....|:|.|.:..:||.....| .|.: |.|..  |.:||||||...:..:.|.:  |.|   :
  Fly     3 LITVTLVIALVAAAQGAKLSDKL-AKLV-PSFAT--GFVINGTEAEPHSAPYIVSL--ATN---Y 58

  Fly    73 FGTGHLCGGSLIRPGWVLTAAHCFVDQIIYDGTFVPKEEFIVVMGNLDRYNRTNTLTFTIEERIM 137
            ....|:|||:||...|::|||||..:.:           .:.::..|......:.||   ::|  
  Fly    59 LKHSHICGGTLINKDWIVTAAHCISEPV-----------GMSIIAGLHTRAEVDELT---QQR-- 107

  Fly   138 QLD------KFDLSTYDKDIALLMLNGTVPTGHPTIRPIAL-NRFAIPEGVVCQVTGWGNTEDGY 195
            |:|      |:.......|||||.:|.:. ..:..::|..| :|..:.||.. .:.|||..: .|
  Fly   108 QVDFGRVHEKYTGGVGPYDIALLHVNESF-IFNEWVQPATLPSREQVHEGET-HLYGWGQPK-SY 169

  Fly   196 V---SDILMTVDVPMISEEHCINDSDLGHLIQPGMICAGYLEVGEKDACAGDSGGPLVCQ----- 252
            :   :..|.||...:::.|.|..:......|....||:..|: ..|.||.||||||||.:     
  Fly   170 IFSGAKTLQTVTTQILNYEECKEELPESAPIAESNICSSSLQ-QSKSACNGDSGGPLVVEFTNAP 233

  Fly   253 SELAGVVSWG-IQCALPRLPGVYTEVSYYYDWI 284
            |||.|:|||| |.|.|..:|.:||:||.|.|||
  Fly   234 SELIGIVSWGYIPCGLANMPSIYTKVSAYIDWI 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6048NP_572282.1 Tryp_SPc 45..284 CDD:214473 81/254 (32%)
CG11911NP_608518.1 Tryp_SPc 37..269 CDD:238113 83/255 (33%)
Tryp_SPc 37..266 CDD:214473 81/253 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.