DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6048 and AgaP_AGAP010243

DIOPT Version :9

Sequence 1:NP_572282.1 Gene:CG6048 / 31528 FlyBaseID:FBgn0029827 Length:362 Species:Drosophila melanogaster
Sequence 2:XP_554157.3 Gene:AgaP_AGAP010243 / 3292148 VectorBaseID:AGAP010243 Length:275 Species:Anopheles gambiae


Alignment Length:246 Identity:88/246 - (35%)
Similarity:118/246 - (47%) Gaps:33/246 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 IINGTEASLGATRHQVGIRKALNDGYFFGTGHLCGGSLIRPGWVLTAAHCFVDQIIYDGTFVPKE 110
            |:.|....:....:||.:|: ||:       |:||||:|...|||||.||..|.|         .
Mosquito    47 IVGGHVVDIEMHPYQVSVRE-LNE-------HICGGSIITNRWVLTAGHCVDDTI---------A 94

  Fly   111 EFIVVMGNLDRYNRTNTLTFTIEERIMQLDKFDLSTYDKDIALLMLNGTVPTGHPTI-RPIALNR 174
            .::.|......|.:..|: ..::......|....| :..|.|||.|...:.  ..|| :|||| .
Mosquito    95 AYMNVRVGSAFYAKGGTI-HPVDSVTTHPDHVPYS-WLADFALLQLKHAIV--FSTIAQPIAL-A 154

  Fly   175 FAIPEGV---VCQVTGWG---NTEDGYVSDILMTVDVPMISEEHCINDSDLGHLIQPGMICAGYL 233
            |.:...:   .|.|||||   |.|:.:  |.|..|.:|::|...| |.:..|.:.|. |||||..
Mosquito   155 FRLDNALSDRECVVTGWGRTLNEEESF--DKLRAVQIPLVSRVLC-NATYEGKIDQT-MICAGDF 215

  Fly   234 EVGEKDACAGDSGGPLVCQSELAGVVSWGIQCALPRLPGVYTEVSYYYDWI 284
            ..|.|.:||.||||||||.....|:||||..||:|..|.||:.|.|...||
Mosquito   216 VDGGKGSCAYDSGGPLVCGDMQVGIVSWGKGCAMPGYPDVYSSVLYARAWI 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6048NP_572282.1 Tryp_SPc 45..284 CDD:214473 86/244 (35%)
AgaP_AGAP010243XP_554157.3 Tryp_SPc 47..269 CDD:238113 88/246 (36%)
Tryp_SPc 47..266 CDD:214473 86/244 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.