DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6048 and AgaP_AGAP007262

DIOPT Version :9

Sequence 1:NP_572282.1 Gene:CG6048 / 31528 FlyBaseID:FBgn0029827 Length:362 Species:Drosophila melanogaster
Sequence 2:XP_564960.3 Gene:AgaP_AGAP007262 / 3290331 VectorBaseID:AGAP007262 Length:316 Species:Anopheles gambiae


Alignment Length:330 Identity:101/330 - (30%)
Similarity:139/330 - (42%) Gaps:77/330 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 VALLLIFLPSGLRGA----TTRTH----LDTKAIRP---------RF--------NADPGRIING 49
            ::|.|:.|.:.|.|.    ||.:.    :|...:||         .|        |....||:||
Mosquito     5 ISLTLVGLLALLHGVSPLPTTSSSSSFGIDWSEVRPIEEFDHIKAHFRTPTTATQNTPNRRIVNG 69

  Fly    50 TEASLGATRHQVGIRKALNDGYFFGTGHLCGGSLIRPGWVLTAAHCFVDQIIYDG--TFVPKEEF 112
            .||..|...:||.:....|.|.     .|||.|:|...:|||||||     :|.|  ...|....
Mosquito    70 QEARPGQFPYQVALLGQFNSGV-----GLCGASIITQRYVLTAAHC-----VYIGVDASTPVANG 124

  Fly   113 IVVMGNLDRYNRTNTLTFTIEERIMQLDKFDLS------TYD-----KDIALLMLNGTVPTGHPT 166
            ..::|   .:||      .|||...|...|..|      .||     .|||::.|:..: .....
Mosquito   125 TAILG---AHNR------MIEEPSQQRITFSASGVIGHPGYDLFDVRNDIAVVRLDEPI-LYTDR 179

  Fly   167 IRPIAL------NRFAIPEGVVCQVTGWG--NTEDGYVSDILMTVDVPMISEEHC-INDSDLGHL 222
            |:||.|      ..||   |::..|:|:|  :|.:..:||:|..|..|:|:...| ...|....|
Mosquito   180 IQPIRLPGRSDTRTFA---GLMGTVSGYGVYSTANPGLSDVLNYVLNPVITNADCRAAWSGFEWL 241

  Fly   223 IQPGMICAGYLEVGEKDACAGDSGGPLVCQ----SELAGVVSWGIQCALPR-LPGVYTEVSYYYD 282
            |:|..:|..  ..|.:.||..||||||..|    |...||||:|....... :|.|:..|:||.|
Mosquito   242 IEPQNVCQS--GDGGRSACNSDSGGPLTVQDNGESLQVGVVSFGSAGGCDNGIPTVFARVTYYLD 304

  Fly   283 WILQN 287
            ||..|
Mosquito   305 WIEAN 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6048NP_572282.1 Tryp_SPc 45..284 CDD:214473 86/265 (32%)
AgaP_AGAP007262XP_564960.3 Tryp_SPc 65..306 CDD:214473 86/265 (32%)
Tryp_SPc 66..309 CDD:238113 87/267 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.