DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6048 and Klk14

DIOPT Version :9

Sequence 1:NP_572282.1 Gene:CG6048 / 31528 FlyBaseID:FBgn0029827 Length:362 Species:Drosophila melanogaster
Sequence 2:NP_777355.1 Gene:Klk14 / 317653 MGIID:2447564 Length:250 Species:Mus musculus


Alignment Length:296 Identity:97/296 - (32%)
Similarity:136/296 - (45%) Gaps:64/296 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LLLIFLPSGLRGATTRTHLDTKAIRPRFNADPGRIINGTEASLGATRHQVGIRKALNDGYFFGTG 76
            ||||.| ..|..|..::..|.|            ||.|......:...||.::.        |.|
Mouse     3 LLLIIL-QALAVAIAQSQGDHK------------IIGGYRCVRNSQPWQVALQA--------GPG 46

  Fly    77 H--LCGGSLIRPGWVLTAAHCFVDQIIYDGTFVPKEEFIVVMG--NLDRYNRTNTLTFTIEERIM 137
            |  ||||.|:...||:||||| ...|::           |.:|  |:.|:..|..:...  .|.:
Mouse    47 HRFLCGGVLLSDQWVITAAHC-ARPILH-----------VALGKHNIRRWEATQQVVRV--ARQV 97

  Fly   138 QLDKFDLSTYDKDIALLMLNGTVPTGHPTIRPIALNRFAIPEGVVCQVTGWGNTEDGYVSDI--- 199
            ...::....:|.|:.||.|...|..|. .::.|::.......|..|:|:|||.    ..|.|   
Mouse    98 PHPQYQPQAHDNDLMLLKLQKKVRLGR-AVKTISVASSCASPGTPCRVSGWGT----IASPIARY 157

  Fly   200 ---LMTVDVPMISEEHCINDSDLGH-----LIQPGMICAGYLEVGEKDACAGDSGGPLVCQSELA 256
               |..|:|.::||:.|       |     :|..||:|||..| |.||:|.|||||||||..:|.
Mouse   158 PTALQCVNVNIMSEQAC-------HRAYPGIITSGMVCAGVPE-GGKDSCQGDSGGPLVCGGQLQ 214

  Fly   257 GVVSWGIQ-CALPRLPGVYTEVSYYYDWILQNMGEN 291
            |:||||:: ||:|..||||..:..|:.||.:.|..|
Mouse   215 GLVSWGMERCAMPGYPGVYANLCNYHSWIQRTMQSN 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6048NP_572282.1 Tryp_SPc 45..284 CDD:214473 84/254 (33%)
Klk14NP_777355.1 Tryp_SPc 24..246 CDD:238113 86/256 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.