DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6048 and Klk15

DIOPT Version :9

Sequence 1:NP_572282.1 Gene:CG6048 / 31528 FlyBaseID:FBgn0029827 Length:362 Species:Drosophila melanogaster
Sequence 2:NP_777354.1 Gene:Klk15 / 317652 MGIID:2447533 Length:254 Species:Mus musculus


Alignment Length:265 Identity:89/265 - (33%)
Similarity:123/265 - (46%) Gaps:47/265 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 DPGRIINGTEASLGATRHQVGIRKALNDGYFFGTGHL-CGGSLIRPGWVLTAAHCFVDQIIYDGT 105
            |..:::.|.|....:...||.:         |..|.. ||..||.|.||||||||          
Mouse    16 DGDKVLEGEECVPHSQPWQVAL---------FERGRFNCGAFLISPRWVLTAAHC---------- 61

  Fly   106 FVPKEEFI-VVMG--NLDRYNRTNTLTFTIEERIMQLDKFDLSTYDKDIALLML-NGTVPTGHPT 166
               :..|: |.:|  ||.:::....|...  .||:....::..|:..||.||.| .....|.:  
Mouse    62 ---QTRFMRVRLGEHNLRKFDGPEQLRSV--SRIIPHPGYEARTHRHDIMLLRLFKPARLTAY-- 119

  Fly   167 IRPIALNRFAIPEGVVCQVTGWGNTEDG------------YVSDILMTVDVPMISEEHCINDSDL 219
            :||:||.|.....|..|.|:|||...|.            .:.|.|...::.:|||..|  :.|.
Mouse   120 VRPVALPRRCPLIGEDCVVSGWGLLSDNNPGATGSQKSHVRLPDTLHCANISIISEASC--NKDY 182

  Fly   220 GHLIQPGMICAGYLEVGEKDACAGDSGGPLVCQSELAGVVSWG-IQCALPRLPGVYTEVSYYYDW 283
            ...:.|.|:||| :|.|..|:|.|||||||||...|.|:|||| :.|.....|||||:|..|.:|
Mouse   183 PGRVLPTMVCAG-VEGGGTDSCEGDSGGPLVCGGALQGIVSWGDVPCDTTTKPGVYTKVCSYLEW 246

  Fly   284 ILQNM 288
            |.:|:
Mouse   247 IWENV 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6048NP_572282.1 Tryp_SPc 45..284 CDD:214473 85/256 (33%)
Klk15NP_777354.1 Tryp_SPc 23..247 CDD:238113 85/252 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BGUI
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.