DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6048 and LOC312273

DIOPT Version :9

Sequence 1:NP_572282.1 Gene:CG6048 / 31528 FlyBaseID:FBgn0029827 Length:362 Species:Drosophila melanogaster
Sequence 2:NP_001101326.1 Gene:LOC312273 / 312273 RGDID:1563848 Length:246 Species:Rattus norvegicus


Alignment Length:270 Identity:95/270 - (35%)
Similarity:130/270 - (48%) Gaps:37/270 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 THLDTKAIRPRFNADPGRIINGTEASLGATRHQVGIRKALNDGYFFGTGHLCGGSLIRPGWVLTA 92
            |.|.|.|..|..:.| .||:.|....    .|.|..:.:||.|     .|:||||||...|||:|
  Rat     8 TLLGTVAAFPTEDND-DRIVGGYTCQ----EHSVPYQVSLNAG-----SHICGGSLITDQWVLSA 62

  Fly    93 AHCFVDQIIYDGTFVPKEEFIVVMGNLDRYNRTNTLTFTIEERIMQLDKFDLSTYDKDIALLMLN 157
            |||:..|:            .|.:|..:.|.......|....:::....:|..|.|.||.|:.|.
  Rat    63 AHCYHPQL------------QVRLGEHNIYEIEGAEQFIDAAKMILHPDYDKWTVDNDIMLIKLK 115

  Fly   158 GTVPTGHPTIRPIALNRFAIPEGVVCQVTGWGNTEDGYVS-DILMTVDVPMISEEHCINDSDLGH 221
            ... |.:..:..|.|.::....|..|.|:|||..:.|:.| .:|..:|.|::|:..|       |
  Rat   116 SPA-TLNSKVSTIPLPQYCPTAGTECLVSGWGVLKFGFESPSVLQCLDAPVLSDSVC-------H 172

  Fly   222 LIQP-----GMICAGYLEVGEKDACAGDSGGPLVCQSELAGVVSWGIQCALPRLPGVYTEVSYYY 281
            ...|     .|.|.|:|| |.||:|..|||||:||..|:.|:||||..|||...|||||:|..|.
  Rat   173 KAYPRQITNNMFCLGFLE-GGKDSCQYDSGGPVVCNGEVQGIVSWGDGCALEGKPGVYTKVCNYL 236

  Fly   282 DWILQNMGEN 291
            :||.|.:.||
  Rat   237 NWIHQTIAEN 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6048NP_572282.1 Tryp_SPc 45..284 CDD:214473 84/244 (34%)
LOC312273NP_001101326.1 Tryp_SPc 25..242 CDD:238113 85/246 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.