DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6048 and Tmprss3

DIOPT Version :9

Sequence 1:NP_572282.1 Gene:CG6048 / 31528 FlyBaseID:FBgn0029827 Length:362 Species:Drosophila melanogaster
Sequence 2:XP_038954650.1 Gene:Tmprss3 / 309665 RGDID:1310135 Length:454 Species:Rattus norvegicus


Alignment Length:279 Identity:104/279 - (37%)
Similarity:148/279 - (53%) Gaps:31/279 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 LRGATTRTHLDT---KAIRPRFNADPGRIINGTEASLGATRHQVGIRKALNDGYFFGTGHLCGGS 82
            :|...|..|:.|   .|...|....| ||:.|..:||.....||.::   ..||     ||||||
  Rat   190 MREGCTSGHVVTLKCSACGMRTGYSP-RIVGGNVSSLTQWPWQVSLQ---FQGY-----HLCGGS 245

  Fly    83 LIRPGWVLTAAHCFVDQIIYDGTFVPKEEFIVVMGNLDRYNRTNTLTFTIEERIMQLDKFDLSTY 147
            :|.|.|::|||||     :|| .:.|| .:.|.:|.:...:  :.:...:.|:|:...|:.....
  Rat   246 VITPLWIVTAAHC-----VYD-LYHPK-SWTVQVGLVSLMD--SPVPSHLVEKIIYHSKYKPKRL 301

  Fly   148 DKDIALLMLNGTVPTGHPTIRPIAL--NRFAIPEGVVCQVTGWGNTEDGY--VSDILMTVDVPMI 208
            ..||||:.|:..: |...||:||.|  :....|:|.:|..:|||.||||.  .|.:|....||:|
  Rat   302 GNDIALMKLSEPL-TFDETIQPICLPNSEENFPDGKLCWTSGWGATEDGAGDASPVLNHAAVPLI 365

  Fly   209 SEEHCINDSDLGHLIQPGMICAGYLEVGEKDACAGDSGGPLVCQS----ELAGVVSWGIQCALPR 269
            |.:.|.:....|.:|.|.|:|||||: |..|:|.||||||||||.    :|.|..|:||.||...
  Rat   366 SNKICNHRDVYGGIISPSMLCAGYLK-GGVDSCQGDSGGPLVCQERRLWKLVGATSFGIGCAEVN 429

  Fly   270 LPGVYTEVSYYYDWILQNM 288
            .|||||.::.:.|||.:.:
  Rat   430 KPGVYTRITSFLDWIHEQL 448

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6048NP_572282.1 Tryp_SPc 45..284 CDD:214473 95/246 (39%)
Tmprss3XP_038954650.1 LDLa 74..107 CDD:238060
SRCR_2 112..211 CDD:406055 5/20 (25%)
Tryp_SPc 216..444 CDD:214473 95/246 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.