DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6048 and Klk8

DIOPT Version :9

Sequence 1:NP_572282.1 Gene:CG6048 / 31528 FlyBaseID:FBgn0029827 Length:362 Species:Drosophila melanogaster
Sequence 2:NP_001100979.1 Gene:Klk8 / 308565 RGDID:1305998 Length:260 Species:Rattus norvegicus


Alignment Length:285 Identity:84/285 - (29%)
Similarity:122/285 - (42%) Gaps:46/285 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LLIFLPSGLRGATTRTHLDTKAIRPRFNADPGRIINGTEASLGATRHQVGIRKALNDGYFFGTGH 77
            :|:||..|.....||             |...:|:.|.|....:...|..:        |.|...
  Rat    13 ILLFLLMGAWAGLTR-------------AQGSKILEGQECKPHSQPWQTAL--------FQGERL 56

  Fly    78 LCGGSLIRPGWVLTAAHCFVDQIIYDGTFVPKEEFIVVMGNLDRYNRTNTLTFTIEERIMQLDKF 142
            :|||.|:...||||||||            .|:::.|.:|:.....|..........|.:|...|
  Rat    57 VCGGVLVGDRWVLTAAHC------------KKDKYSVRLGDHSLQKRDEPEQEIQVARSIQHPCF 109

  Fly   143 DLST---YDKDIALLMLNGTVPTGHPTIRPIALNRFAIPEGVVCQVTGWG---NTEDGYVSDILM 201
            :.|.   :..||.|:.|..:...| ..::||.|.......|..|.::|||   :.::.: .:.|.
  Rat   110 NSSNPEDHSHDIMLIRLQNSANLG-DKVKPIELANLCPKVGQKCIISGWGTVTSPQENF-PNTLN 172

  Fly   202 TVDVPMISEEHCINDSDLGHLIQPGMICAGYLEVGEKDACAGDSGGPLVCQSELAGVVSWGIQ-C 265
            ..:|.:.|:..|  :......|..||:|||  .....|.|.|||||||||...|.|:.|||.. |
  Rat   173 CAEVKIYSQNKC--ERAYPGKITEGMVCAG--SSNGADTCQGDSGGPLVCNGVLQGITSWGSDPC 233

  Fly   266 ALPRLPGVYTEVSYYYDWILQNMGE 290
            ..|..|||||::..|.:||.:.||:
  Rat   234 GKPEKPGVYTKICRYTNWIKKTMGK 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6048NP_572282.1 Tryp_SPc 45..284 CDD:214473 73/245 (30%)
Klk8NP_001100979.1 Tryp_SPc 32..252 CDD:214473 73/245 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.