DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6048 and Klk12

DIOPT Version :9

Sequence 1:NP_572282.1 Gene:CG6048 / 31528 FlyBaseID:FBgn0029827 Length:362 Species:Drosophila melanogaster
Sequence 2:XP_008757573.1 Gene:Klk12 / 308564 RGDID:1308975 Length:247 Species:Rattus norvegicus


Alignment Length:266 Identity:90/266 - (33%)
Similarity:123/266 - (46%) Gaps:64/266 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 ADPGRIINGTEASLGATRHQVGIRKALNDGYFFGTGHLCGGSLIRPGWVLTAAHCFVDQIIYDGT 105
            ||..:|.||.|....:...|||:        |.|....|||.|:...||||||||          
  Rat    17 ADREKIYNGVECVKNSQPWQVGL--------FHGKYLRCGGVLVDRKWVLTAAHC---------- 63

  Fly   106 FVPKEEFIVVMG--NLDRYNRTNTLTFTIEERIMQLDKFDLS---------TYDKDIALLMLNGT 159
               ..:::|.:|  :|.:.:.|..|         :|..|.::         .::.|:.||.||..
  Rat    64 ---SGKYMVRLGEHSLSKLDLTEQL---------RLTTFSITHPSYHGAYQNHEHDLRLLRLNRP 116

  Fly   160 VPTGHPTIRPIALNRFAIPEGVVCQVTGWGNTEDGY--VSDILMTVDVPMISEEHCINDSDLGHL 222
            :...: .:||:||.....|.|..|.::|||.|...:  ..|.|..:|:.::|.|.|       ..
  Rat   117 ISLTY-AVRPVALPSSCAPTGAKCHISGWGTTNKPWDPFPDRLQCLDLSIVSNETC-------RA 173

  Fly   223 IQPG-----MICAGYLEVGE--KDACAGDSGGPLVCQSELAGVVSWGI--QCALPRLPGVYTEVS 278
            :.||     |:|||    ||  ||||.|||||||||...|.|:||||.  .|....:|||||:|.
  Rat   174 VFPGRVTENMLCAG----GEAGKDACQGDSGGPLVCGGVLQGLVSWGSVGPCGQKGIPGVYTKVC 234

  Fly   279 YYYDWI 284
            .|.|||
  Rat   235 KYTDWI 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6048NP_572282.1 Tryp_SPc 45..284 CDD:214473 86/260 (33%)
Klk12XP_008757573.1 Tryp_SPc 21..240 CDD:214473 86/260 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BGUI
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.