DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6048 and Tmprss11e

DIOPT Version :9

Sequence 1:NP_572282.1 Gene:CG6048 / 31528 FlyBaseID:FBgn0029827 Length:362 Species:Drosophila melanogaster
Sequence 2:XP_038948843.1 Gene:Tmprss11e / 305265 RGDID:1561698 Length:444 Species:Rattus norvegicus


Alignment Length:266 Identity:94/266 - (35%)
Similarity:127/266 - (47%) Gaps:55/266 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 RIINGTEASLGATRHQVGIRKALNDGYFFGTGHLCGGSLIRPGWVLTAAHCF---VDQIIYDGTF 106
            ||:.||.|..|....|..::.   ||     .|.||.:||...|:::|||||   .|...:..:|
  Rat   212 RIVGGTSAEEGEWPWQSSLQW---DG-----SHRCGATLISNTWLVSAAHCFRTHKDPSRWTASF 268

  Fly   107 -----VPKEEFIVVMGNLDRYNRTNTLTFTIEERIMQLDKFDLSTYDKDIALLMLNGTVPTGHPT 166
                 .||                  ||..| .||:..:|::..::|.||||:.|:..||..:  
  Rat   269 GATLQPPK------------------LTTGI-RRIIVHEKYNYPSHDYDIALVELSRPVPCTN-- 312

  Fly   167 IRPIALNRFAIPE-------GVVCQVTGWGN-TEDGYVSDILMTVDVPMISEEHCINDSDLGHLI 223
                |:::..:|:       |....|||:|. ..||:..:.|..|.|..|..:.|.........|
  Rat   313 ----AVHKVCLPDANHEFQPGQRMFVTGFGALRNDGFAQNYLRQVQVDYIDTQTCNRPQSYNGAI 373

  Fly   224 QPGMICAGYLEVGEKDACAGDSGGPLVCQS-----ELAGVVSWGIQCALPRLPGVYTEVSYYYDW 283
            .|.|:|||:|: ||||||.||||||||...     .||||||||.:|..|..|||||.|:.:.||
  Rat   374 TPRMLCAGFLK-GEKDACQGDSGGPLVTPDVRDVWYLAGVVSWGDECGQPNKPGVYTRVTAFRDW 437

  Fly   284 ILQNMG 289
            |..|.|
  Rat   438 ITSNTG 443

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6048NP_572282.1 Tryp_SPc 45..284 CDD:214473 90/259 (35%)
Tmprss11eXP_038948843.1 SEA 71..176 CDD:396113
Tryp_SPc 213..441 CDD:238113 91/261 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.