DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6048 and HABP2

DIOPT Version :9

Sequence 1:NP_572282.1 Gene:CG6048 / 31528 FlyBaseID:FBgn0029827 Length:362 Species:Drosophila melanogaster
Sequence 2:NP_004123.1 Gene:HABP2 / 3026 HGNCID:4798 Length:560 Species:Homo sapiens


Alignment Length:257 Identity:87/257 - (33%)
Similarity:128/257 - (49%) Gaps:36/257 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 RIINGTEASLGATRHQVGIRKALNDGYFFGTGHLCGGSLIRPGWVLTAAHCFVDQIIYDGTFVPK 109
            ||..|.:::.|....|..::.:|........||.|||:||.|.||||||||         |.:..
Human   313 RIYGGFKSTAGKHPWQASLQSSLPLTISMPQGHFCGGALIHPCWVLTAAHC---------TDIKT 368

  Fly   110 EEFIVVMGNLD-RYNRTNTLTFTIEERIMQLDKFDLSTYDK-------DIALLMLNGTVPTGH-- 164
            ....||:|:.| :....:..:|.:|:      .|..|.|::       |||||.|...  .||  
Human   369 RHLKVVLGDQDLKKEEFHEQSFRVEK------IFKYSHYNERDEIPHNDIALLKLKPV--DGHCA 425

  Fly   165 ---PTIRPIALNRFAIPEGVVCQVTGWGNTEDGYVSDILMTVDVPMISEEHCINDSDLGHLIQPG 226
               ..::.:.|...:.|.|..|.::|||.||.|..|..|:...|.:|:...|.:.....|:|...
Human   426 LESKYVKTVCLPDGSFPSGSECHISGWGVTETGKGSRQLLDAKVKLIANTLCNSRQLYDHMIDDS 490

  Fly   227 MICAGYLEVGEKDACAGDSGGPLVCQSE----LAGVVSWGIQCALPRLPGVYTEVSYYYDWI 284
            |||||.|:...:|.|.|||||||.|:.:    :.|:||||::|.  :.|||||:|:.:.:||
Human   491 MICAGNLQKPGQDTCQGDSGGPLTCEKDGTYYVYGIVSWGLECG--KRPGVYTQVTKFLNWI 550

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6048NP_572282.1 Tryp_SPc 45..284 CDD:214473 85/255 (33%)
HABP2NP_004123.1 EGF 77..106 CDD:306513
KR 191..277 CDD:238056
Tryp_SPc 314..553 CDD:238113 86/256 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S6411
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.860

Return to query results.
Submit another query.