DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6048 and Klk7

DIOPT Version :9

Sequence 1:NP_572282.1 Gene:CG6048 / 31528 FlyBaseID:FBgn0029827 Length:362 Species:Drosophila melanogaster
Sequence 2:XP_017444408.1 Gene:Klk7 / 292852 RGDID:1306420 Length:249 Species:Rattus norvegicus


Alignment Length:260 Identity:85/260 - (32%)
Similarity:119/260 - (45%) Gaps:55/260 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 RIINGTEASLGATRHQVGIRKALNDGYFFGTGHLCGGSLIRPGWVLTAAHCFVDQIIYDGTFVPK 109
            |||:|.:...|:...||.:.|        |....|||.|:...||||||||.:.|          
  Rat    25 RIIDGYKCKEGSHPWQVALLK--------GDQLHCGGVLVGESWVLTAAHCKMGQ---------- 71

  Fly   110 EEFIVVMGNLDRYNRTNTLTFTIEERIMQLDK---------FDLSTYDKDIALLMLNGTVPTGHP 165
              :.|.:|: |:          ||::..|..|         :...|:..||.|:.::..|... .
  Rat    72 --YTVHLGS-DK----------IEDQSAQRIKASRSFRHPGYSTRTHVNDIMLVKMDKPVKMS-D 122

  Fly   166 TIRPIALNRFAIPEGVVCQVTGWGNT---EDGYVSDILMTVDVPMISEEHC---INDSDLGHLIQ 224
            .::.:.|.....|.|.:|.|:|||.|   :..:.|| ||..||.:||.:.|   ..|     |:.
  Rat   123 KVQKVKLPDHCEPPGTLCTVSGWGTTTSPDVTFPSD-LMCSDVKLISSQECKKVYKD-----LLG 181

  Fly   225 PGMICAGYLEVGEKDACAGDSGGPLVCQSELAGVVSWG-IQCALPRLPGVYTEVSYYYDWILQNM 288
            ..|:||| :...:.:.|.|||||||||...|.|:|||| ..|..|..|||||:|..|..|:...|
  Rat   182 KTMLCAG-IPDSKTNTCNGDSGGPLVCNDTLQGLVSWGTYPCGQPNDPGVYTQVCKYQRWLEDTM 245

  Fly   289  288
              Rat   246  245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6048NP_572282.1 Tryp_SPc 45..284 CDD:214473 83/254 (33%)
Klk7XP_017444408.1 Tryp_SPc 25..240 CDD:214473 83/253 (33%)
Tryp_SPc 26..244 CDD:238113 83/256 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.