DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6048 and Mcpt2

DIOPT Version :9

Sequence 1:NP_572282.1 Gene:CG6048 / 31528 FlyBaseID:FBgn0029827 Length:362 Species:Drosophila melanogaster
Sequence 2:NP_742041.1 Gene:Mcpt2 / 29266 RGDID:621058 Length:247 Species:Rattus norvegicus


Alignment Length:282 Identity:80/282 - (28%)
Similarity:115/282 - (40%) Gaps:58/282 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LLLIFLPSGLRGATTRTHLDTKAIRPRFNADPGRIINGTEASLGATRHQVGIRKALNDGYFFGTG 76
            |:.:.||||                    |....||.|.| |:..:|..:.....:.:.   |..
  Rat     7 LMALLLPSG--------------------AGAEEIIGGVE-SIPHSRPYMAHLDIVTEK---GLR 47

  Fly    77 HLCGGSLIRPGWVLTAAHCFVDQIIYDGTFVPKEEFIVVMGNLDRYNRTNT-LTFTIEERIMQLD 140
            .:|||.||...:|||||||            ...|..|::|..|...|.:| ....:|::|:.  
  Rat    48 VICGGFLISRQFVLTAAHC------------KGREITVILGAHDVRKRESTQQKIKVEKQIIH-- 98

  Fly   141 KFDLSTYDK-----DIALLMLNGTVP-TGHPTIRPIALNRFAIPEGVVCQVTGWGNT--EDGYVS 197
                .:|:.     ||.||.|...|. |....:.|:......|..|.:|...|||.|  .|. .|
  Rat    99 ----ESYNSVPNLHDIMLLKLEKKVELTPAVNVVPLPSPSDFIHPGAMCWAAGWGKTGVRDP-TS 158

  Fly   198 DILMTVDVPMISEEHCINDSDLGHLIQPGMICAGYLEVGEKDACAGDSGGPLVCQSELAGVVSWG 262
            ..|..|::.::.|:.|:   |..:......:|.| .....:.|..|||||||:|.....|:||:|
  Rat   159 YTLREVELRIMDEKACV---DYRYYEYKFQVCVG-SPTTLRAAFMGDSGGPLLCAGVAHGIVSYG 219

  Fly   263 IQCALPRLPGVYTEVSYYYDWI 284
            ...|.|  |.::|.||.|..||
  Rat   220 HPDAKP--PAIFTRVSTYVPWI 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6048NP_572282.1 Tryp_SPc 45..284 CDD:214473 72/247 (29%)
Mcpt2NP_742041.1 Tryp_SPc 20..239 CDD:214473 72/247 (29%)
Tryp_SPc 21..242 CDD:238113 74/248 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.