DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6048 and Klk6

DIOPT Version :9

Sequence 1:NP_572282.1 Gene:CG6048 / 31528 FlyBaseID:FBgn0029827 Length:362 Species:Drosophila melanogaster
Sequence 2:NP_062048.1 Gene:Klk6 / 29245 RGDID:3419 Length:251 Species:Rattus norvegicus


Alignment Length:266 Identity:86/266 - (32%)
Similarity:125/266 - (46%) Gaps:50/266 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 FNADPGRIINGTEASLGATRHQVGIRKALNDGYFFGTGH-LCGGSLIRPGWVLTAAHCFVDQIIY 102
            ::.|..::::|......:...|..:         :.:|| ||||.|:.|.||||||||       
  Rat    22 WSEDQDKVVHGGPCLKNSHPFQAAL---------YTSGHLLCGGVLVGPQWVLTAAHC------- 70

  Fly   103 DGTFVPKEEFIVVMGNLDRYNRTNTLTFTIEERIMQLD------KFDLSTYDKDIALLMLNGTVP 161
                 .|....|.:|   ::|...|.||   :|.:.:|      :::..|:|.||.::.|...|.
  Rat    71 -----KKPNLEVYLG---KHNLRQTETF---QRQISVDRTIVHPRYNPQTHDNDIMMVHLKRPVK 124

  Fly   162 TGHPTIRPIALNRFAIPEGVVCQVTGWGNTEDGYVSDILMTVDVPMISEEHCINDSDLGHLIQPG 226
            ... .|:|:.|.:....:...||:.|||..|:|...|.:...||.::|.|.|       ....||
  Rat   125 FSQ-RIQPLPLKKDCSEKNPDCQILGWGKMENGEFPDTIQCADVQLVSREEC-------ERAYPG 181

  Fly   227 -----MICAGYLEVGEKDACAGDSGGPLVCQSELAGVVSWG-IQCALPRLPGVYTEVSYYYDWIL 285
                 |:|||....| .|:|.|||||||||...|.|:|||| :.|.....|||||:|..:..|| 
  Rat   182 KITRSMVCAGDKREG-NDSCQGDSGGPLVCGGHLRGIVSWGDMPCGSKEKPGVYTDVCTHIRWI- 244

  Fly   286 QNMGEN 291
            ||:..|
  Rat   245 QNIIRN 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6048NP_572282.1 Tryp_SPc 45..284 CDD:214473 80/251 (32%)
Klk6NP_062048.1 Tryp_SPc 28..244 CDD:214473 80/251 (32%)
Tryp_SPc 29..247 CDD:238113 83/254 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.