DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6048 and KLK9

DIOPT Version :9

Sequence 1:NP_572282.1 Gene:CG6048 / 31528 FlyBaseID:FBgn0029827 Length:362 Species:Drosophila melanogaster
Sequence 2:NP_036447.1 Gene:KLK9 / 284366 HGNCID:6370 Length:250 Species:Homo sapiens


Alignment Length:306 Identity:91/306 - (29%)
Similarity:133/306 - (43%) Gaps:76/306 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LGQLLAVALLLIFLPSGLRGATTRTHLDTKAIRPRFNADPGRIINGTEASLGATRHQVGIRKALN 68
            ||.|.|:..||    :|...|.||. :..:..||  |:.|.:.                      
Human     3 LGLLCALLSLL----AGHGWADTRA-IGAEECRP--NSQPWQA---------------------- 38

  Fly    69 DGYFFGTGHLCGGSLIRPGWVLTAAHCFVDQIIYDGTFVPKEEFIVVMGNLDRYNRTNTLTFTIE 133
             |.|..|...||.:||...|:||||||             ::.::.|     |....:...:...
Human    39 -GLFHLTRLFCGATLISDRWLLTAAHC-------------RKPYLWV-----RLGEHHLWKWEGP 84

  Fly   134 ERIMQLDKF--------DLSTYD--KDIALLMLNGTVPTGHPTIRPIALNRFAIPEGVVCQVTGW 188
            |::.::..|        |||..|  .||.|:.|....... |.::|:.|::..:..|:.|.::||
Human    85 EQLFRVTDFFPHPGFNKDLSANDHNDDIMLIRLPRQARLS-PAVQPLNLSQTCVSPGMQCLISGW 148

  Fly   189 G--NTEDGYVSDILMTVDVPMISEEHCINDSDLGHLIQPG-----MICAGYLEVGEKDACAGDSG 246
            |  ::........|...::.::..:.|       |...||     |:|||..| |.:.:|.||||
Human   149 GAVSSPKALFPVTLQCANISILENKLC-------HWAYPGHISDSMLCAGLWE-GGRGSCQGDSG 205

  Fly   247 GPLVCQSELAGVVSWGIQ-CALPRLPGVYTEVSYYYDWILQNMGEN 291
            |||||...||||||.|.: |:.||.|.|||.|.:|.||| |.:.||
Human   206 GPLVCNGTLAGVVSGGAEPCSRPRRPAVYTSVCHYLDWI-QEIMEN 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6048NP_572282.1 Tryp_SPc 45..284 CDD:214473 72/256 (28%)
KLK9NP_036447.1 Tryp_SPc 24..247 CDD:238113 79/275 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BGUI
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.