DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6048 and KLK13

DIOPT Version :9

Sequence 1:NP_572282.1 Gene:CG6048 / 31528 FlyBaseID:FBgn0029827 Length:362 Species:Drosophila melanogaster
Sequence 2:NP_056411.1 Gene:KLK13 / 26085 HGNCID:6361 Length:277 Species:Homo sapiens


Alignment Length:221 Identity:81/221 - (36%)
Similarity:110/221 - (49%) Gaps:28/221 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 LCGGSLIRPGWVLTAAHCFVDQI-IYDGTFVPKEEFIVVMGNLDRYNRTNTLTFTIEERIMQLDK 141
            ||||.|:.|.||||||||..:.: :|.|..        .:|.::...:...:..:|.....:...
Human    60 LCGGVLVHPKWVLTAAHCLKEGLKVYLGKH--------ALGRVEAGEQVREVVHSIPHPEYRRSP 116

  Fly   142 FDLSTYDKDIALLMLNGTVP-TGHPTIRPIALNRFAIPEGVVCQVTGWGNTEDGYVS--DILMTV 203
            ..|: :|.||.||.|...|. ||:....|::.|....| |..|:|:|||.|....|:  ..|...
Human   117 THLN-HDHDIMLLELQSPVQLTGYIQTLPLSHNNRLTP-GTTCRVSGWGTTTSPQVNYPKTLQCA 179

  Fly   204 DVPMISEEHCINDSDLGHLIQPG-----MICAGYLEVGEKDACAGDSGGPLVCQSELAGVVSWG- 262
            ::.:.|:|.|       ..:.||     |:|||..| |.||:|.|||||||||...|.|:|||| 
Human   180 NIQLRSDEEC-------RQVYPGKITDNMLCAGTKE-GGKDSCEGDSGGPLVCNRTLYGIVSWGD 236

  Fly   263 IQCALPRLPGVYTEVSYYYDWILQNM 288
            ..|..|..|||||.||.|..||.:.:
Human   237 FPCGQPDRPGVYTRVSRYVLWIRETI 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6048NP_572282.1 Tryp_SPc 45..284 CDD:214473 79/215 (37%)
KLK13NP_056411.1 Tryp_SPc 38..261 CDD:238113 81/218 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BGUI
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.