DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6048 and KLK5

DIOPT Version :9

Sequence 1:NP_572282.1 Gene:CG6048 / 31528 FlyBaseID:FBgn0029827 Length:362 Species:Drosophila melanogaster
Sequence 2:NP_001070959.1 Gene:KLK5 / 25818 HGNCID:6366 Length:293 Species:Homo sapiens


Alignment Length:265 Identity:79/265 - (29%)
Similarity:123/265 - (46%) Gaps:42/265 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 RFNADPGRIINGTEASLGATRHQVGIRKALNDGYFFGTGHLCGGSLIRPGWVLTAAHCFVDQIIY 102
            |.:....|||||::..:.....|..:....|..|       ||..|:.|.|:||||||       
Human    59 RSDDSSSRIINGSDCDMHTQPWQAALLLRPNQLY-------CGAVLVHPQWLLTAAHC------- 109

  Fly   103 DGTFVPKEEFIVVMGNLDRYNRTNTLTFTIEERIMQLDK------FDLSTYDKDIALLMLNGTVP 161
                 .|:.|.|.:|:   |:.:.  .:...:::.|..|      :....:..|:.|:.||..: 
Human   110 -----RKKVFRVRLGH---YSLSP--VYESGQQMFQGVKSIPHPGYSHPGHSNDLMLIKLNRRI- 163

  Fly   162 TGHPT--IRPIALNRFAIPEGVVCQVTGWGNTEDGYV--SDILMTVDVPMISEEHCINDSDLGHL 222
              .||  :|||.::......|..|.|:|||.|:...|  ..:|..:::.::|::.|  :......
Human   164 --RPTKDVRPINVSSHCPSAGTKCLVSGWGTTKSPQVHFPKVLQCLNISVLSQKRC--EDAYPRQ 224

  Fly   223 IQPGMICAGYLEVGEKDACAGDSGGPLVCQSELAGVVSWG-IQCALPRLPGVYTEVSYYYDWILQ 286
            |...|.|||  :...:|:|.||||||:||...|.|:|||| ..||.|..|||||.:..:..||.:
Human   225 IDDTMFCAG--DKAGRDSCQGDSGGPVVCNGSLQGLVSWGDYPCARPNRPGVYTNLCKFTKWIQE 287

  Fly   287 NMGEN 291
            .:..|
Human   288 TIQAN 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6048NP_572282.1 Tryp_SPc 45..284 CDD:214473 75/249 (30%)
KLK5NP_001070959.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 37..68 2/8 (25%)
Tryp_SPc 66..285 CDD:214473 75/249 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.