DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6048 and Klk1

DIOPT Version :9

Sequence 1:NP_572282.1 Gene:CG6048 / 31528 FlyBaseID:FBgn0029827 Length:362 Species:Drosophila melanogaster
Sequence 2:NP_036725.1 Gene:Klk1 / 24523 RGDID:2969 Length:261 Species:Rattus norvegicus


Alignment Length:288 Identity:88/288 - (30%)
Similarity:119/288 - (41%) Gaps:82/288 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 ADPG--RIINGTEASLGATRHQVGIRKALNDGYFFGTGHLCGGSLIRPGWVLTAAHCFVDQIIYD 103
            |.||  |:|.|.:....:...||.:       |.| |.:||||.||.|.||:|||||        
  Rat    18 APPGQSRVIGGYKCEKNSQPWQVAL-------YSF-TKYLCGGVLIDPSWVITAAHC-------- 66

  Fly   104 GTFVPKEEFIVVMGNLDRYNRTNTLTFTIEERIMQLDKFDLSTY----------------DKDIA 152
                ....:.|.:|   |.|......|.....:.|  .|....|                ..|:.
  Rat    67 ----SSNNYQVWLG---RNNLLEDEPFAQHRLVSQ--SFPHPDYKPFLMRNHTRKPGDDHSNDLM 122

  Fly   153 LLMLNG-----------TVPTGHPTIRPIALNRFAIPEGVVCQVTGWGNTED--GYVSDILMTVD 204
            ||.|:.           .:||..|.:            |..|..:|||:|:.  ....|.|..|:
  Rat   123 LLHLSQPADITDGVKVIDLPTEEPKV------------GSTCLASGWGSTKPLIWEFPDDLQCVN 175

  Fly   205 VPMISEEHCIND-----SDLGHLIQPGMICAGYLEVGEKDACAGDSGGPLVCQSELAGVVSWG-I 263
            :.::|.|.||..     :||       |:|||.|| |.||.|.|||||||:|...|.|:.||| :
  Rat   176 IHLLSNEKCIKAYKEKVTDL-------MLCAGELE-GGKDTCTGDSGGPLLCDGVLQGITSWGSV 232

  Fly   264 QCALPRLPGVYTEVSYYYDWILQNMGEN 291
            .||...:|.:||::..:..||.:.|.||
  Rat   233 PCAKTNMPAIYTKLIKFTSWIKEVMKEN 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6048NP_572282.1 Tryp_SPc 45..284 CDD:214473 80/273 (29%)
Klk1NP_036725.1 Tryp_SPc 24..253 CDD:214473 80/273 (29%)
Tryp_SPc 25..256 CDD:238113 81/275 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.