DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6048 and Klk7

DIOPT Version :9

Sequence 1:NP_572282.1 Gene:CG6048 / 31528 FlyBaseID:FBgn0029827 Length:362 Species:Drosophila melanogaster
Sequence 2:NP_036002.1 Gene:Klk7 / 23993 MGIID:1346336 Length:249 Species:Mus musculus


Alignment Length:256 Identity:84/256 - (32%)
Similarity:116/256 - (45%) Gaps:47/256 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 RIINGTEASLGATRHQVGIRKALNDGYFFGTGHLCGGSLIRPGWVLTAAHCFVDQIIYDGTFVPK 109
            |||:|.:...|:...||.:.|        |....|||.|:...||||||||.:.|          
Mouse    25 RIIDGYKCKEGSHPWQVALLK--------GNQLHCGGVLVDKYWVLTAAHCKMGQ---------- 71

  Fly   110 EEFIVVMGNLDRYNRTNTLTFTIEERIMQLDKF-----DLSTYDKDIALLMLNGTVPTGHPTIRP 169
              :.|.:|: |:....:.      ::|.....|     ...|:..||.|:.|:..|... ..:..
Mouse    72 --YQVQLGS-DKIGDQSA------QKIKATKSFRHPGYSTKTHVNDIMLVRLDEPVKMS-SKVEA 126

  Fly   170 IALNRFAIPEGVVCQVTGWGNT---EDGYVSDILMTVDVPMISEEHC---INDSDLGHLIQPGMI 228
            :.|.....|.|..|.|:|||.|   :..:.|| ||..||.:||...|   ..|     |:...|:
Mouse   127 VQLPEHCEPPGTSCTVSGWGTTTSPDVTFPSD-LMCSDVKLISSRECKKVYKD-----LLGKTML 185

  Fly   229 CAGYLEVGEKDACAGDSGGPLVCQSELAGVVSWG-IQCALPRLPGVYTEVSYYYDWILQNM 288
            ||| :...:.:.|.|||||||||...|.|:|||| ..|..|..|||||:|..|..|:::.|
Mouse   186 CAG-IPDSKTNTCNGDSGGPLVCNDTLQGLVSWGTYPCGQPNDPGVYTQVCKYKRWVMETM 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6048NP_572282.1 Tryp_SPc 45..284 CDD:214473 82/250 (33%)
Klk7NP_036002.1 Tryp_SPc 25..241 CDD:214473 82/250 (33%)
Serine protease. /evidence=ECO:0000250 26..246 83/255 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.