DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6048 and PRSS55

DIOPT Version :9

Sequence 1:NP_572282.1 Gene:CG6048 / 31528 FlyBaseID:FBgn0029827 Length:362 Species:Drosophila melanogaster
Sequence 2:NP_940866.2 Gene:PRSS55 / 203074 HGNCID:30824 Length:352 Species:Homo sapiens


Alignment Length:273 Identity:92/273 - (33%)
Similarity:122/273 - (44%) Gaps:63/273 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 RPRFNADPGRIINGTEASLGATRHQVGIRKALNDGYFFGTGHLCGGSLIRPGWVLTAAHCFVDQI 100
            |.|::    ||..|.||.:|....||.| :|.::.:       ||||::...|:||||||     
Human    62 RTRYS----RITGGMEAEVGEFPWQVSI-QARSEPF-------CGGSILNKWWILTAAHC----- 109

  Fly   101 IYDGTFVPKEEFIVVMGNLDRYNRTNTLT---FTIEE--RIMQLDKFDLSTYDKDIALLMLNGTV 160
            :|.....| ||..||:|       ||.||   ..|:|  .|:....|..:..|.|||||:|    
Human   110 LYSEELFP-EELSVVLG-------TNDLTSPSMEIKEVASIILHKDFKRANMDNDIALLLL---- 162

  Fly   161 PTGHPTIRPIALNRFAIP------EGVV----CQVTGWGNT---EDGYVSDILMTVDVPMISEEH 212
                  ..||.|:...:|      .|..    |.|.|||.|   :...|...||...:.::..|.
Human   163 ------ASPIKLDDLKVPICLPTQPGPATWRECWVAGWGQTNAADKNSVKTDLMKAPMVIMDWEE 221

  Fly   213 CINDSDLGHLIQPGMICAGYLEVGEKDACAGDSGGPLVCQSE------LAGVVSWGIQCALPRLP 271
            |   |.:...:...|:|||| :....|||.|||||||||..|      ..|::|||..|.....|
Human   222 C---SKMFPKLTKNMLCAGY-KNESYDACKGDSGGPLVCTPEPGEKWYQVGIISWGKSCGEKNTP 282

  Fly   272 GVYTEVSYYYDWI 284
            |:||.:..|..||
Human   283 GIYTSLVNYNLWI 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6048NP_572282.1 Tryp_SPc 45..284 CDD:214473 88/262 (34%)
PRSS55NP_940866.2 Tryp_SPc 67..295 CDD:214473 88/262 (34%)
Tryp_SPc 68..298 CDD:238113 89/263 (34%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 308..330
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.