DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6048 and Klk6

DIOPT Version :9

Sequence 1:NP_572282.1 Gene:CG6048 / 31528 FlyBaseID:FBgn0029827 Length:362 Species:Drosophila melanogaster
Sequence 2:NP_001158168.1 Gene:Klk6 / 19144 MGIID:1343166 Length:253 Species:Mus musculus


Alignment Length:227 Identity:84/227 - (37%)
Similarity:117/227 - (51%) Gaps:31/227 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 FGTGH-LCGGSLIRPGWVLTAAHCFVDQIIYDGTFVPKEEFIVVMGNLDRYNRTNTLTFTIEERI 136
            :.:|| ||||.||.|.||||||||            .|....|::|   ::|...|.||   :|.
Mouse    47 YTSGHLLCGGVLIDPQWVLTAAHC------------KKPNLQVILG---KHNLRQTETF---QRQ 93

  Fly   137 MQLD------KFDLSTYDKDIALLMLNGTVPTGHPTIRPIALNRFAIPEGVVCQVTGWGNTEDGY 195
            :.:|      :::..|:|.||.::.|...|... ..|:|:.|......|...||:.|||..|:|.
Mouse    94 ISVDRTIVHPRYNPETHDNDIMMVHLKNPVKFS-KKIQPLPLKNDCSEENPNCQILGWGKMENGD 157

  Fly   196 VSDILMTVDVPMISEEHCINDSDLGHLIQPGMICAGYLEVGEKDACAGDSGGPLVCQSELAGVVS 260
            ..|.:...||.::..|.| ..:..|.:.| .|:|||.::.| .|:|.|||||||||...|.|:||
Mouse   158 FPDTIQCADVHLVPREQC-ERAYPGKITQ-SMVCAGDMKEG-NDSCQGDSGGPLVCGGRLRGLVS 219

  Fly   261 WG-IQCALPRLPGVYTEVSYYYDWILQNMGEN 291
            || :.|.....|||||:|..:..|| ||:..|
Mouse   220 WGDMPCGSKEKPGVYTDVCTHIRWI-QNILRN 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6048NP_572282.1 Tryp_SPc 45..284 CDD:214473 79/218 (36%)
Klk6NP_001158168.1 Tryp_SPc 28..244 CDD:214473 79/218 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.