DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6048 and Klk1b4

DIOPT Version :9

Sequence 1:NP_572282.1 Gene:CG6048 / 31528 FlyBaseID:FBgn0029827 Length:362 Species:Drosophila melanogaster
Sequence 2:NP_035045.2 Gene:Klk1b4 / 18048 MGIID:97320 Length:256 Species:Mus musculus


Alignment Length:241 Identity:73/241 - (30%)
Similarity:107/241 - (44%) Gaps:58/241 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 CGGSLIRPGWVLTAAHCFVDQIIYDGTFVPKEEFIVVMGNLDRYNRTNTLTFTIEERIMQLDKFD 143
            |||.|:...||||||||:.|:  |. .::.|..|:.     |..:..:.|   :.:.|...| |:
Mouse    45 CGGVLLDRNWVLTAAHCYNDK--YQ-VWLGKNNFLE-----DEPSDQHRL---VSKAIPHPD-FN 97

  Fly   144 LS-----------TYDKDIALLMLNG-----------TVPTGHPTIRPIALNRFAIPEGVVCQVT 186
            :|           .|..|:.||.|:.           |:||..|.:            |..|..:
Mouse    98 MSLLNEHTPQPEDDYSNDLMLLRLSKPADITDVVKPITLPTEEPKL------------GSTCLAS 150

  Fly   187 GWGNT---EDGYVSDILMTVDVPMISEEHCINDSDLGH--LIQPGMICAGYLEVGEKDACAGDSG 246
            |||:|   :..|..| |..|::.::..|.|    |..|  .:...|:|||.:: |....|..|||
Mouse   151 GWGSTTPIKFKYPDD-LQCVNLKLLPNEDC----DKAHEMKVTDAMLCAGEMD-GGSYTCEHDSG 209

  Fly   247 GPLVCQSELAGVVSWGIQ-CALPRLPGVYTEVSYYYDWILQNMGEN 291
            |||:|...|.|:.|||.: |..|..|.|||::..:..||.:.|..|
Mouse   210 GPLICDGILQGITSWGPEPCGEPTEPSVYTKLIKFSSWIRETMANN 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6048NP_572282.1 Tryp_SPc 45..284 CDD:214473 69/232 (30%)
Klk1b4NP_035045.2 Tryp_SPc 13..251 CDD:238113 71/235 (30%)
Activation peptide homolog 18..24
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.