DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6048 and try-1

DIOPT Version :9

Sequence 1:NP_572282.1 Gene:CG6048 / 31528 FlyBaseID:FBgn0029827 Length:362 Species:Drosophila melanogaster
Sequence 2:NP_494910.2 Gene:try-1 / 173856 WormBaseID:WBGene00006619 Length:293 Species:Caenorhabditis elegans


Alignment Length:259 Identity:91/259 - (35%)
Similarity:123/259 - (47%) Gaps:50/259 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 RIINGTEASLGATRHQVGIRKALNDGYFFGTGHLCGGSLIRPGWVLTAAHCFV-DQIIYDGTFVP 108
            |:|.|:|:|..:....|.:...|..       |.||||||.|.:||||||||. |:       .|
 Worm    57 RLIGGSESSPHSWPWTVQLLSRLGH-------HRCGGSLIDPNFVLTAAHCFAKDR-------RP 107

  Fly   109 KEEFIVVMGNLDRYNRTNTLT-----------FTIEERIMQLDKFDLSTYDKDIALLMLNGTVPT 162
            ....:.|.|:.......:.:|           |.             |:|  |.|::.::..|.|
 Worm   108 TSYSVRVGGHRSGSGSPHRVTAVSIHPWYNIGFP-------------SSY--DFAIMRIHPPVNT 157

  Fly   163 GHPTIRPIALNRFAIPEGVVCQVTGWGNTEDG--YVSDILMTVDVPMISEEHCIN-DSDLGHLIQ 224
            . .|.|||.|......|..:|.|||||:|.:|  ..:..|..:.||::|...|.: .:.:|.:..
 Worm   158 S-TTARPICLPSLPAVENRLCVVTGWGSTIEGSSLSAPTLREIHVPLLSTLFCSSLPNYIGRIHL 221

  Fly   225 PGMICAGYLEVGEKDACAGDSGGPLVCQS----ELAGVVSWGIQCALPRLPGVYTEVSYYYDWI 284
            |.|:|||| ..|:.|:|.|||||||:|..    ||.|||||||.||.|.:||||..|.....||
 Worm   222 PSMLCAGY-SYGKIDSCQGDSGGPLMCARDGHWELTGVVSWGIGCARPGMPGVYGNVHSASTWI 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6048NP_572282.1 Tryp_SPc 45..284 CDD:214473 89/257 (35%)
try-1NP_494910.2 Tryp_SPc 59..285 CDD:238113 90/257 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.