DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6048 and CFD

DIOPT Version :9

Sequence 1:NP_572282.1 Gene:CG6048 / 31528 FlyBaseID:FBgn0029827 Length:362 Species:Drosophila melanogaster
Sequence 2:NP_001304264.1 Gene:CFD / 1675 HGNCID:2771 Length:260 Species:Homo sapiens


Alignment Length:255 Identity:84/255 - (32%)
Similarity:118/255 - (46%) Gaps:29/255 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 AIRPRFNADPGRIINGTEASLGATRHQVGIRKALNDGYFFGTGHLCGGSLIRPGWVLTAAHCFVD 98
            |..||     |||:.|.||...|..:...::  ||.      .|||||.|:...|||:||||..|
Human    26 AAPPR-----GRILGGREAEAHARPYMASVQ--LNG------AHLCGGVLVAEQWVLSAAHCLED 77

  Fly    99 QIIYDGTFVPKEEFIVVMGNLDRYNRTNTLTFTIEERIMQLDKFDLSTYDKDIALLMLNGTVPTG 163
            ..  ||    |.:.::...:|.:...:..| :.:...:...|. ...|.|.|:.||.|:.....|
Human    78 AA--DG----KVQVLLGAHSLSQPEPSKRL-YDVLRAVPHPDS-QPDTIDHDLLLLQLSEKATLG 134

  Fly   164 HPTIRPIALNRF--AIPEGVVCQVTGWGNTED-GYVSDILMTVDVPMISEEHCINDSDLGHLIQP 225
             |.:||:...|.  .:..|.:|.|.|||.... |...|.|..|.:|::....|...:.....|..
Human   135 -PAVRPLPWQRVDRDVAPGTLCDVAGWGIVNHAGRRPDSLQHVLLPVLDRATCNRRTHHDGAITE 198

  Fly   226 GMICAGYLEVGEKDACAGDSGGPLVCQSELAGVVSWGIQ-CALPRLPGVYTEVSYYYDWI 284
            .::||   |...:|:|.|||||||||...|.|||:.|.: |...:.||:||.|:.|..||
Human   199 RLMCA---ESNRRDSCKGDSGGPLVCGGVLEGVVTSGSRVCGNRKKPGIYTRVASYAAWI 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6048NP_572282.1 Tryp_SPc 45..284 CDD:214473 78/242 (32%)
CFDNP_001304264.1 Tryp_SPc 32..255 CDD:214473 78/242 (32%)
Tryp_SPc 33..258 CDD:238113 79/243 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.