DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6048 and Klk1b1

DIOPT Version :9

Sequence 1:NP_572282.1 Gene:CG6048 / 31528 FlyBaseID:FBgn0029827 Length:362 Species:Drosophila melanogaster
Sequence 2:NP_034775.1 Gene:Klk1b1 / 16623 MGIID:892019 Length:261 Species:Mus musculus


Alignment Length:297 Identity:80/297 - (26%)
Similarity:124/297 - (41%) Gaps:58/297 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LLIFLPSGLRGATTRTHLDTKAIRPRFNADP---GRIINGTEASLGATRHQVGIRKALNDGYFFG 74
            |::||...|.|               .:|.|   .||:.|.:....:....|.:.:...      
Mouse     4 LILFLALSLGG---------------IDAAPPVQSRIVGGFKCEKNSQPWHVAVYRYKE------ 47

  Fly    75 TGHLCGGSLIRPGWVLTAAHCFVDQIIYDGTFVPKEEFIVVMGNLDRYNRTNTLTFTIEERIMQL 139
              ::|||.|:...||||||||:.            |:..|.:|..:.|....:....:..:....
Mouse    48 --YICGGVLLDANWVLTAAHCYY------------EKNNVWLGKNNLYQDEPSAQHRLVSKSFLH 98

  Fly   140 DKFDLS-----------TYDKDIALLMLNGTVPTGHPTIRPIALNRFAIPEGVVCQVTGWGN--- 190
            ..:::|           .|..|:.||.|:..... ...::||||.......|..|..:|||:   
Mouse    99 PCYNMSLHRNRIQNPQDDYSYDLMLLRLSKPADI-TDVVKPIALPTEEPKLGSTCLASGWGSIIP 162

  Fly   191 TEDGYVSDILMTVDVPMISEEHCINDSDLGHLIQPGMICAGYLEVGEKDACAGDSGGPLVCQSEL 255
            .:..|..| |..|::.::..|.|  |......:...|:||| ::.|.||.|.|||||||:|...|
Mouse   163 VKFQYAKD-LQCVNLKLLPNEDC--DKAYVQKVTDVMLCAG-VKGGGKDTCKGDSGGPLICDGVL 223

  Fly   256 AGVVSWGIQ-CALPRLPGVYTEVSYYYDWILQNMGEN 291
            .|:.|||.. |..|:.|||||::..:..||...:.:|
Mouse   224 QGLTSWGYNPCGEPKKPGVYTKLIKFTSWIKDTLAQN 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6048NP_572282.1 Tryp_SPc 45..284 CDD:214473 70/253 (28%)
Klk1b1NP_034775.1 Tryp_SPc 24..253 CDD:214473 70/253 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.