DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6048 and TMPRSS6

DIOPT Version :9

Sequence 1:NP_572282.1 Gene:CG6048 / 31528 FlyBaseID:FBgn0029827 Length:362 Species:Drosophila melanogaster
Sequence 2:NP_001275929.1 Gene:TMPRSS6 / 164656 HGNCID:16517 Length:824 Species:Homo sapiens


Alignment Length:302 Identity:91/302 - (30%)
Similarity:140/302 - (46%) Gaps:66/302 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 RGATTRTHLDTKAIRPRFNADPGRIINGTEASLGATRHQVGIRKALNDGYFFGTGHLCGGSLIRP 86
            |..:...|.|.....|     ..||:.|..:|.|....|..::        ....|:|||:||..
Human   549 RDGSDEEHCDCGLQGP-----SSRIVGGAVSSEGEWPWQASLQ--------VRGRHICGGALIAD 600

  Fly    87 GWVLTAAHCFVDQIIYDGTFVPKEEFIVVMGNLDRYNR-TNTLTFTIEERIMQLDKFDLSTYDKD 150
            .||:||||||.:..:.....     :.|.:|.:.:.:| ...::|.: .|::.....:..::|.|
Human   601 RWVITAAHCFQEDSMASTVL-----WTVFLGKVWQNSRWPGEVSFKV-SRLLLHPYHEEDSHDYD 659

  Fly   151 IALLMLNGTVPTGHPTIRPIALNRFAIP-------EGVVCQVTGWGNTEDGY------------- 195
            :|||.|:      ||.:|..|:....:|       .|:.|.:||||...:|.             
Human   660 VALLQLD------HPVVRSAAVRPVCLPARSHFFEPGLHCWITGWGALREGALRADAVALFYGWR 718

  Fly   196 ----------VSDILMTVDVPMISEEHCINDSDL-GHLIQPGMICAGYLEVGEKDACAGDSGGPL 249
                      :|:.|..|||.:|.::.|   |:: .:.:.|.|:||||.: |:||||.|||||||
Human   719 NQGSETCCCPISNALQKVDVQLIPQDLC---SEVYRYQVTPRMLCAGYRK-GKKDACQGDSGGPL 779

  Fly   250 VCQS-----ELAGVVSWGIQCALPRLPGVYTEVSYYYDWILQ 286
            ||::     .|||:||||:.|..|...||||.::....||.|
Human   780 VCKALSGRWFLAGLVSWGLGCGRPNYFGVYTRITGVISWIQQ 821

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6048NP_572282.1 Tryp_SPc 45..284 CDD:214473 84/275 (31%)
TMPRSS6NP_001275929.1 SEA 77..177 CDD:307516
CUB 326..440 CDD:238001
LDLa 450..480 CDD:238060
LDLa 486..516 CDD:238060
Ldl_recept_a 520..557 CDD:278486 1/7 (14%)
Tryp_SPc 568..822 CDD:238113 86/278 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.