DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6048 and Gzmk

DIOPT Version :9

Sequence 1:NP_572282.1 Gene:CG6048 / 31528 FlyBaseID:FBgn0029827 Length:362 Species:Drosophila melanogaster
Sequence 2:NP_032222.1 Gene:Gzmk / 14945 MGIID:1298232 Length:263 Species:Mus musculus


Alignment Length:248 Identity:83/248 - (33%)
Similarity:126/248 - (50%) Gaps:29/248 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 IINGTEASLGATRHQVGIRKALNDGYFFGTGHLCGGSLIRPGWVLTAAHCFVDQIIYDGTFVPK- 109
            ||.|.|....:......|:        :.:.|:|||.||.|.||||||||:        ::.|: 
Mouse    26 IIGGREVQPHSRPFMASIQ--------YRSKHICGGVLIHPQWVLTAAHCY--------SWFPRG 74

  Fly   110 EEFIVVMG--NLDRYNRTNTLTFTIEERIMQLDKFDLSTYDKDIALLMLNGTVPTGHPTIRPIAL 172
            ....||:|  :|.: |.....||.| ::.:...:....:...||.|:.|. |....:..::.:.|
Mouse    75 HSPTVVLGAHSLSK-NEPMKQTFEI-KKFIPFSRLQSGSASHDIMLIKLR-TAAELNKNVQLLHL 136

  Fly   173 -NRFAIPEGVVCQVTGWGNTEDGYV--SDILMTVDVPMISEEHCINDSDLGH--LIQPGMICAGY 232
             ::..:.:|..|||||||.|:...:  ||.|..|.|.:||.:.|.:.|...|  :|...|||||.
Mouse   137 GSKNYLRDGTKCQVTGWGTTKPDLLTASDTLREVTVTIISRKRCNSQSYYNHKPVITKDMICAGD 201

  Fly   233 LEVGEKDACAGDSGGPLVCQSELAGVVSWGIQCALPRLPGVYTEVS-YYYDWI 284
            .. |:||:|.|||||||:|:.....:||.|.:|.:.:.||:||.:: .|..||
Mouse   202 AR-GQKDSCKGDSGGPLICKGIFHALVSQGYKCGIAKKPGIYTLLTKKYQTWI 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6048NP_572282.1 Tryp_SPc 45..284 CDD:214473 81/246 (33%)
GzmkNP_032222.1 Tryp_SPc 25..253 CDD:214473 81/246 (33%)
Tryp_SPc 26..256 CDD:238113 83/248 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.