DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6048 and Egfbp2

DIOPT Version :9

Sequence 1:NP_572282.1 Gene:CG6048 / 31528 FlyBaseID:FBgn0029827 Length:362 Species:Drosophila melanogaster
Sequence 2:NP_034245.3 Gene:Egfbp2 / 13647 MGIID:95292 Length:261 Species:Mus musculus


Alignment Length:307 Identity:81/307 - (26%)
Similarity:122/307 - (39%) Gaps:78/307 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LLIFLPSGLRGATTRTHLDTKAIRPRFNADPGRIINGTEASLGATRHQVGIRKALNDGYFFGTGH 77
            |::||...|.|......|.:            |::.|......:...||.:        ::...|
Mouse     4 LILFLALSLGGIDAAPPLQS------------RVVGGFNCKKNSQPWQVAV--------YYQKEH 48

  Fly    78 LCGGSLIRPGWVLTAAHCFVDQIIYDGTFVPKEEFIVVMGNLDRYNRTNTLTFTIEERIMQLDKF 142
            :|||.|:...||||||||:|||            :.|.:|....:....:....:..:......|
Mouse    49 ICGGVLLDRNWVLTAAHCYVDQ------------YEVWLGKNKLFQEEPSAQHRLVSKSFPHPGF 101

  Fly   143 DLSTYDKDIALLMLNGTVPTG------------------HPTIRPIALNRFAIPEGVVCQVTGWG 189
            ::|       ||||. |:|.|                  ...::||||.......|..|..:|||
Mouse   102 NMS-------LLMLQ-TIPPGADFSNDLMLLRLSKPADITDVVKPIALPTKEPKPGSKCLASGWG 158

  Fly   190 N-TEDGYVS-DILMTVDVPMISEEHC-------INDSDLGHLIQPGMICAGYLEVGEKDACAGDS 245
            : |...:.. |.|..|.:.::..|:|       :.|.         |:|||.:. |.||.|..||
Mouse   159 SITPTRWQKPDDLQCVFITLLPNENCAKVYLQKVTDV---------MLCAGEMG-GGKDTCRDDS 213

  Fly   246 GGPLVCQSELAGVVSWG-IQCALPRLPGVYTEVSYYYDWILQNMGEN 291
            ||||:|...|.|..|:| :.|..|.:|.:||.:..:..||...|.:|
Mouse   214 GGPLICDGILQGTTSYGPVPCGKPGVPAIYTNLIKFNSWIKDTMMKN 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6048NP_572282.1 Tryp_SPc 45..284 CDD:214473 71/266 (27%)
Egfbp2NP_034245.3 Tryp_SPc 24..253 CDD:214473 71/266 (27%)
Tryp_SPc 25..256 CDD:238113 72/268 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.