DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6048 and PRSS21

DIOPT Version :9

Sequence 1:NP_572282.1 Gene:CG6048 / 31528 FlyBaseID:FBgn0029827 Length:362 Species:Drosophila melanogaster
Sequence 2:NP_006790.1 Gene:PRSS21 / 10942 HGNCID:9485 Length:314 Species:Homo sapiens


Alignment Length:340 Identity:101/340 - (29%)
Similarity:137/340 - (40%) Gaps:88/340 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LGQLLAVALLLIFLPSGLRGATTRTHLDTKAIRPRFNADP-----------GRIINGTEASLGAT 57
            :|...|:.|.|:...:|||...::            .|.|           .||:.|.:|.||..
Human     1 MGARGALLLALLLARAGLRKPESQ------------EAAPLSGPCGRRVITSRIVGGEDAELGRW 53

  Fly    58 RHQVGIRKALNDGYFFGTGHLCGGSLIRPGWVLTAAHCFVDQ---------IIYDGTFVPKEEFI 113
            ..|..:|        ....|:||.||:...|.|||||||...         ::..|.......|.
Human    54 PWQGSLR--------LWDSHVCGVSLLSHRWALTAAHCFETYSDLSDPSGWMVQFGQLTSMPSFW 110

  Fly   114 VVMGNLDRYNRTNTLTFTIEERIMQLDKFDLSTYDKDIALLMLNGTVP-TGHPTIRPIAL--NRF 175
            .:.....||..:|          :.|....|.....||||:.|:..|. |.|  |:||.|  :.|
Human   111 SLQAYYTRYFVSN----------IYLSPRYLGNSPYDIALVKLSAPVTYTKH--IQPICLQASTF 163

  Fly   176 AIPEGVVCQVTGWGNTEDGYVSD--------ILMTVDVPMISEEHCINDSDLGHL---------I 223
            .......|.||||     ||:.:        .|..|.|.:|:...|      .||         |
Human   164 EFENRTDCWVTGW-----GYIKEDEALPSPHTLQEVQVAIINNSMC------NHLFLKYSFRKDI 217

  Fly   224 QPGMICAGYLEVGEKDACAGDSGGPLVCQSE----LAGVVSWGIQCALPRLPGVYTEVSYYYDWI 284
            ...|:|||..: |.||||.|||||||.|...    ..||||||:.|..|..|||||.:|::::||
Human   218 FGDMVCAGNAQ-GGKDACFGDSGGPLACNKNGLWYQIGVVSWGVGCGRPNRPGVYTNISHHFEWI 281

  Fly   285 LQNMGENGEGSGEES 299
            .:.|.::|....:.|
Human   282 QKLMAQSGMSQPDPS 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6048NP_572282.1 Tryp_SPc 45..284 CDD:214473 87/271 (32%)
PRSS21NP_006790.1 Tryp_SPc 42..283 CDD:238113 88/272 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BGUI
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.