DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6048 and Klk5

DIOPT Version :9

Sequence 1:NP_572282.1 Gene:CG6048 / 31528 FlyBaseID:FBgn0029827 Length:362 Species:Drosophila melanogaster
Sequence 2:XP_038952099.1 Gene:Klk5 / 102546758 RGDID:1593461 Length:293 Species:Rattus norvegicus


Alignment Length:294 Identity:84/294 - (28%)
Similarity:130/294 - (44%) Gaps:60/294 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 SGLRGATTRTHLDTKAIRPRFNA-------DPGRIINGTEASLGATRHQVGIRKALNDGYFFGTG 76
            ||.:.:.|...|:|.:     |:       ...||:||::........|..:....|..|     
  Rat    39 SGTKPSGTNRDLNTDS-----NSGEDTRSDSSSRIVNGSDCPKDTQPWQGALLLGPNKLY----- 93

  Fly    77 HLCGGSLIRPGWVLTAAHCFVDQIIYDGTFVPKEEFIVVMGNLDRYNRTNTLTFTIEERIMQLDK 141
              ||..||.|.|:||||||            .|..|.:.:|     :.:.:..:...:::.|..|
  Rat    94 --CGAVLINPQWLLTAAHC------------RKPVFRIRLG-----HHSMSPVYESGQQMFQGIK 139

  Fly   142 ------FDLSTYDKDIALLMLNGTVPTGHPTIRPIALNRFAIPEGVVCQVTGWGNTEDGY--VSD 198
                  :....:..|:.|:.:|..:...| :::|:.:......||..|.|:|||.|...:  ...
  Rat   140 SIPHPGYSHPGHSNDLMLIKMNRKIRASH-SVKPVEITSDCPKEGTRCMVSGWGTTSSSHNNFPK 203

  Fly   199 ILMTVDVPMISEEHCINDSDLGHLIQPG-----MICAGYLEVGEKDACAGDSGGPLVCQSELAGV 258
            :|..:|:.::|||.|.|.       .||     |.|||. |.| :|:|.||||||::|..:|.|:
  Rat   204 VLQCLDITVLSEERCKNS-------YPGQIDKTMFCAGD-EAG-RDSCQGDSGGPVICNGKLQGL 259

  Fly   259 VSWG-IQCALPRLPGVYTEVSYYYDWILQNMGEN 291
            |||| ..||.|..|||||.:..:..||...:..|
  Rat   260 VSWGDFPCAQPNRPGVYTNLCEFVPWIKDTIHSN 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6048NP_572282.1 Tryp_SPc 45..284 CDD:214473 75/252 (30%)
Klk5XP_038952099.1 Tryp_SPc 67..286 CDD:214473 75/252 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.