DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6048 and LOC101733979

DIOPT Version :9

Sequence 1:NP_572282.1 Gene:CG6048 / 31528 FlyBaseID:FBgn0029827 Length:362 Species:Drosophila melanogaster
Sequence 2:XP_031749509.1 Gene:LOC101733979 / 101733979 -ID:- Length:895 Species:Xenopus tropicalis


Alignment Length:292 Identity:91/292 - (31%)
Similarity:119/292 - (40%) Gaps:56/292 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 INGTE-ASLGATRHQVGIRKALNDGYFFGTGHLCGGSLIRPGWVLTAAHCFVDQIIYDGTFVPKE 110
            |.|:: .|.|....||.:.|   ||     ..:|||:||...||:||||||...:..|..|    
 Frog   321 IQGSDPRSPGVWPWQVDLHK---DG-----RRMCGGTLISANWVVTAAHCFTGTLSSDSPF---- 373

  Fly   111 EFIVVMGNLDRYNRTNTLTFTIEERIMQLDKFDLSTYDKDIALLMLNGTVPTGHPTIRPIALNRF 175
            ::.||:.     ..|..:..|..::|.....:..:...||||||.|......| |...|:.|.|.
 Frog   374 DWSVVLA-----PGTPAVKETPVQKITLHGAYVSTENGKDIALLQLTRPASFG-PYTLPVCLPRA 432

  Fly   176 A--IPEGVVCQVTGWGNTEDGYVSDILM----TVDVPMISEEHC------INDSDLGHLIQPGMI 228
            :  :..|..|    |....||...|..|    ...|.:|....|      ...::....:.|.|:
 Frog   433 SHRLLYGATC----WHTGRDGPHPDGKMGPPKGASVELIGPNKCNCIYSKPGTTNASVSVLPSML 493

  Fly   229 CAGYLEVGEKDACAGDSGGPLVCQSE----LAGVVSWGIQCALPR---LPGVYTEVSYYYDWI-- 284
            ||...| |:   |..||||||||...    |.||.|:...|...|   ||||||::|.|.:||  
 Frog   494 CAAQQE-GQ---CLSDSGGPLVCNESGTWFLVGVQSFAGSCQERRGKALPGVYTKLSDYENWIST 554

  Fly   285 --------LQNMGENGEGSGEESGEGSGEGSG 308
                    ||......|...|...|||..|.|
 Frog   555 ITRDAFFSLQKETPPQELDSERCSEGSSIGCG 586

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6048NP_572282.1 Tryp_SPc 45..284 CDD:214473 80/256 (31%)
LOC101733979XP_031749509.1 Tryp_SPc 39..282 CDD:238113
Tryp_SPc 323..555 CDD:238113 81/257 (32%)
Tryp_SPc 598..824 CDD:238113
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.