DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6048 and LOC101732176

DIOPT Version :9

Sequence 1:NP_572282.1 Gene:CG6048 / 31528 FlyBaseID:FBgn0029827 Length:362 Species:Drosophila melanogaster
Sequence 2:XP_031752403.1 Gene:LOC101732176 / 101732176 -ID:- Length:516 Species:Xenopus tropicalis


Alignment Length:279 Identity:100/279 - (35%)
Similarity:134/279 - (48%) Gaps:29/279 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 TTRTHLDTKAIRPRFNAD-PGRIINGTEASLGATRHQVGIRKALNDGYFFGTG-HLCGGSLIRPG 87
            ||.|.:..:.|....:.. ..||:.||.|..|....|:.:.|.:      ||. :|||||:|.|.
 Frog   255 TTGTMVSLRCINCGLSTKVDNRIVGGTFALAGDWPWQISLMKLV------GTSLYLCGGSIITPY 313

  Fly    88 WVLTAAHCFVDQIIYDGTFVPKEEFIVVMGN--LDRYNRTNTLTFTIEERIMQLDKFDLSTYDKD 150
            |::|||||     :|..|..| ..|.|..|:  |..|.....|.    :|::....:..:|.:.|
 Frog   314 WIVTAAHC-----VYGYTSSP-SIFKVFAGSLTLSNYYSAGYLV----DRVLIHPSYSPNTQNYD 368

  Fly   151 IALLMLNGTVPTGHPTIRPIALNRFAIP--EGVVCQVTGWGNT-EDGYVSDILMTVDVPMISEEH 212
            ||||.|. |.......:||:.|....:|  :|..|.::|||.| |.|.:|..|....||:||...
 Frog   369 IALLKLK-TALVFSTNLRPVCLPNVGMPWADGQPCWISGWGTTSEAGSISTSLKAASVPIISSAT 432

  Fly   213 CINDSDLGHLIQPGMICAGYLEVGEKDACAGDSGGPLVCQSE----LAGVVSWGIQCALPRLPGV 273
            |......|.:|.|.|||||||. |..|.|.||||||||.::.    |.|..|||..||....|||
 Frog   433 CNLAPVYGGVISPTMICAGYLG-GGTDTCQGDSGGPLVTKTNSLWWLVGDTSWGYGCARAYKPGV 496

  Fly   274 YTEVSYYYDWILQNMGENG 292
            |..::.:.:||...|...|
 Frog   497 YGNITVFLEWIYSQMQTYG 515

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6048NP_572282.1 Tryp_SPc 45..284 CDD:214473 92/248 (37%)
LOC101732176XP_031752403.1 LDLa <115..133 CDD:238060
LDLa 140..171 CDD:238060
SRCR_2 176..271 CDD:406055 4/15 (27%)
Tryp_SPc 277..510 CDD:238113 93/250 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.