DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6048 and LOC101732100

DIOPT Version :9

Sequence 1:NP_572282.1 Gene:CG6048 / 31528 FlyBaseID:FBgn0029827 Length:362 Species:Drosophila melanogaster
Sequence 2:XP_031749505.1 Gene:LOC101732100 / 101732100 -ID:- Length:327 Species:Xenopus tropicalis


Alignment Length:266 Identity:83/266 - (31%)
Similarity:110/266 - (41%) Gaps:59/266 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 RIINGTEASLGATRHQV-----GIRKALNDGYFFGTGHLCGGSLIRPGWVLTAAHCFVDQ----- 99
            ||:.|.:|..|....|.     |:             :.|||:|:...||::||||....     
 Frog    36 RIVGGQDAKKGKYPWQALLWCPGV-------------YRCGGTLVSSKWVVSAAHCLSRSNASCL 87

  Fly   100 -IIYDGTFV---PKEEFIVVMGNL---DRYNRTNTLTFTIEERIMQLDKFDLSTYDKDIALLMLN 157
             :|.....:   ..||..|.:.|:   ..||.|:...             |:...:...|:...:
 Frog    88 AVILGANKLSGNENEEMAVSVKNIYIHPNYNDTDITN-------------DIGLAELTQAVSFTS 139

  Fly   158 GTVPTGHPTIRPIALNRFAIPEGVVCQVTGWGNTE--DGYVSDILMTVDVPMISEEHCINDSD-- 218
            ..:|...||...|      ...|..|.|||||.||  .....:.|..|.:.::|.|.|.:..|  
 Frog   140 YVIPVCLPTASTI------FNPGQSCWVTGWGVTEFNTSLSPNTLQEVQMRILSAEQCRSYYDPN 198

  Fly   219 -LGHLIQPGMICAGYLEVGEKDACAGDSGGPLVC----QSELAGVVSWGIQCALPRLPGVYTEVS 278
             .|..|...||||..: :|.||:|.|||||||||    ...|.||||:||.|.....|||||.|.
 Frog   199 ITGVYITDQMICARDI-LGGKDSCQGDSGGPLVCSYGGNFYLVGVVSFGIGCGDTAYPGVYTYVP 262

  Fly   279 YYYDWI 284
            .|.|||
 Frog   263 AYRDWI 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6048NP_572282.1 Tryp_SPc 45..284 CDD:214473 81/264 (31%)
LOC101732100XP_031749505.1 Tryp_SPc 37..268 CDD:238113 80/263 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.