DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6048 and si:ch73-182e20.4

DIOPT Version :9

Sequence 1:NP_572282.1 Gene:CG6048 / 31528 FlyBaseID:FBgn0029827 Length:362 Species:Drosophila melanogaster
Sequence 2:XP_009296334.2 Gene:si:ch73-182e20.4 / 100535157 ZFINID:ZDB-GENE-131127-155 Length:341 Species:Danio rerio


Alignment Length:284 Identity:99/284 - (34%)
Similarity:132/284 - (46%) Gaps:51/284 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 RPRFNADPGRIINGTEASLGATRHQVGIRKALNDGYFFGTGHLCGGSLIRPGWVLTAAHCFVDQI 100
            ||....:| ||:.|..::.||....|.:|       ::| .|:||||||...||||||||     
Zfish    62 RPNPQLNP-RIVGGLNSTEGAWPWMVSLR-------YYG-NHICGGSLINNEWVLTAAHC----- 112

  Fly   101 IYDGTFVPKEEFIVVMGNLDRYNR-TNTLTFTIEERIMQLDKFDLSTYDKDIALLMLNGTVPTGH 164
                ..:.:...:|.:|...||.. .|.:|.|: ..|:....::.:|||.|||||.|:.||   |
Zfish   113 ----VNLTRSNMLVYLGKWRRYAADVNEITRTV-SNIIPHPSYNSTTYDNDIALLQLSSTV---H 169

  Fly   165 PT--IRPIAL--NRFAIPEGVVCQVTGWGN---TEDGYV------------SDILMTVDVPMISE 210
            .:  |:|:.|  .:...|.|.....||||.   :..|.:            ..||..|.:.:.|.
Zfish   170 YSDYIKPVCLADEQSNFPPGTRSWATGWGRIGVSGKGGIRGRTTVSVPLPPPGILQEVKLKVYSN 234

  Fly   211 EHCINDSDLGH-LIQPGMICAGYLEVGEKDACAGDSGGPLVCQS----ELAGVVSWGIQCALPRL 270
            ..|   :.:.| .|.|.||||| ...|.|...:||||||||.:.    ..|||||.|..||.|.|
Zfish   235 ADC---NSICHGRINPNMICAG-TRSGGKATFSGDSGGPLVSKQCSVWVQAGVVSHGYGCAQPNL 295

  Fly   271 PGVYTEVSYYYDWILQNMGENGEG 294
            |.|:..||.|..||...:|.|..|
Zfish   296 PEVFIRVSEYKQWITAAVGGNLPG 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6048NP_572282.1 Tryp_SPc 45..284 CDD:214473 91/263 (35%)
si:ch73-182e20.4XP_009296334.2 Tryp_SPc 71..309 CDD:238113 90/262 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.