DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6048 and tmprss13

DIOPT Version :9

Sequence 1:NP_572282.1 Gene:CG6048 / 31528 FlyBaseID:FBgn0029827 Length:362 Species:Drosophila melanogaster
Sequence 2:XP_002932950.2 Gene:tmprss13 / 100491822 XenbaseID:XB-GENE-940757 Length:462 Species:Xenopus tropicalis


Alignment Length:259 Identity:84/259 - (32%)
Similarity:126/259 - (48%) Gaps:38/259 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 RIINGTEASLGATRHQVGIRKALNDGYFFGTGHLCGGSLIRPGWVLTAAHCFVDQIIYDGTFVPK 109
            |||.|..|.||....||.:.:...:.:    .|:|||::|...||.||.|||.:.       |..
 Frog   221 RIIGGVSAKLGDYPWQVSLHQRAGNRF----AHVCGGTIINNKWVATATHCFQET-------VDP 274

  Fly   110 EEFIVVMGNLDRYNRTNTLTFTIEERIMQLDKFDLSTYDKDIALLMLNGTVPTGHPTIRPIALNR 174
            ..:.|..|.::::|.....|.|:   |::.:.::..|.|.|:||:.:.      .|.|...|:..
 Frog   275 ANWRVYAGIINQHNLNAMHTVTV---IVRNENYNSDTDDFDMALMKMK------QPFIFTAAIQP 330

  Fly   175 FAIP-------EGVVCQVTGWGNT----EDGYVSDILMTVDVPMISEEHCINDSDLGHLIQPGMI 228
            ..:|       :..:|.::|:|.|    ::|  |..||...|.:|....|...:.....|.|.|:
 Frog   331 ACLPMMNQNFGQNDICFISGFGKTIQSSDEG--SQYLMQAQVHVIPTSVCNKVNVYNGAITPRMM 393

  Fly   229 CAGYLEVGEKDACAGDSGGPLVCQS----ELAGVVSWGIQCALPRLPGVYTEVSYYYDWILQNM 288
            |||||: |:.|:|.||||||||||.    .||||.|||..|.....||||:.|:.:..||.:.:
 Frog   394 CAGYLQ-GQIDSCQGDSGGPLVCQQGGIWYLAGVTSWGSGCGQANKPGVYSNVNAFLQWIYKQI 456

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6048NP_572282.1 Tryp_SPc 45..284 CDD:214473 82/253 (32%)
tmprss13XP_002932950.2 SRCR_2 128..217 CDD:382996
Tryp_SPc 222..455 CDD:238113 83/255 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.